[Seite 28↓]

3  Material und Methoden

3.1 Chemikalien und Lösungen

Die verwendeten Chemikalien stammen, soweit nicht anders angegeben, von Sigma-Aldrich Chemie GmbH (Deisenhofen, Deutschland). Bromelain und Triton X-100 wurden bei Fluka (Buchs, Schweiz), Lipofectin® Reaganz und YT-Medium bei Gibco Invitrogen Corporation (Karlsruhe, Deutschland) gekauft.

Als Standardpuffer wurde PBS (phosphate buffered saline), pH 7.4 mit 156 mM NaCl und 150 mM NaH2 PO4 /Na2 HPO4 eingesetzt. PBS+ enthielt zusätzlich 2 mM Mg2+ / 2 mM Ca2+ . Für Messungen bei Werten unter pH 6 wurde Natriumacetat (NaAc)-puffer (130 mM NaCl, 20 mM NaAc) verwendet. Die Zusammensetzung anderer Puffer, die nur für bestimmte Präparationen verwendet wurden, sind in den entsprechenden Abschnitten angegeben.

Für die Zellkultur wurde DMEM (Dulbeccos modified Eagle Medium) von Gibco Invitrogen Corporation (Karlsruhe, Deutschland) mit oder ohne Zusatz von unterschiedlichen Mengen an fetalem Rinderserum (FCS; Gibco Invitrogen Corporation) verwendet. Zum Ernten der Zellen wurde Trypsin (50 µg/ml)/EDTA (20 µ/ml)-Lösung (Biochrom KG, Berlin, Deutschland) benutzt.

Octadecylrhodamin-B-chlorid (R18), Acetomethylester des Calceins (Calcein-AM) und 1,1'-bis(4-anilino)naphthalene-5,5'-disulfonsäure (bis-ANS) wurden bei Molecular Probes (Eugene, OR, USA) gekauft. Von Avanti Polar Lipids (Alabaster, AL, USA) stammt das Triethylammoniumsalz von N-(Lissamintm rhodamine B sulfonyl)-1,2-dioleyl-sn-glycero-3-phosphoethanolamine (N-Rh-PE).

1-[15-(2-ethyl-4,4-dimethyl-3-oxy-2-oxazolidinyl)pentanoyl]lysophosphatidylcholin (SL-LPC; C18) wurde freundlicherweise von Prof. Devaux (Paris, Frankreich) zur Verfügung gestellt.


[Seite 29↓]

3.2  Biologisches Material

Viren

Sendaivirus, Stamm Z

Simianvirus 5, Stamm W3 (Prof. Klenk, Institut für Virologie, Philipp-Universität Marburg)

Influenzavirus, Stamm X-31

Rekombinantes Vakziniavirus vTF7-3 (Prof. M.F.G. Schmidt, Institut Immunologie und Molekulare Biologie, Freie Universität Berlin)

Zellen

Humane Erythrozyten (Deutsches Rotes Kreuz, Berlin, Deutschland)

MDBK, Rinder Nierenzellen (BioWhittaker Europe, Verviers, Belgien)

HepG2, humane Leberkarzinomzellen (ATCC, Manassas, USA)

CV-1, Nierenzellen der Afrikanischen Grünen Meerkatzen (Prof. Klenk, Institut für Virologie, Philipp-Universität Marburg)

Kompetente Zellen von E. coli, Stamm XL1 blue (Prof. M.F.G. Schmidt, Institut für Immunologie und Molekulare Biologie, Freie Universität Berlin)

3.3 Anzucht und Reinigung der Viren

3.3.1 Vermehrung von Sendai- und Influenzaviren

Die Zucht von Sendai- bzw. Influenzaviren erfolgte in befruchteten und 11 Tage bebrüteten Hühnereiern. In die Allantoishöhle der Eier wurden je 100 µl einer eingestellten Virus-Suspension (10-2 -10-1  HAU/ml) inokuliert. Die Eier wurden für 2 Tage bei 37°C bebrütet und dann zur Abtötung der Embryonen bei 4°C über Nacht gelagert. Nach Entfernung der Eischale im Bereich der Luftkammer konnte die Allantoisflüssigkeit entnommen werden.


[Seite 30↓]

3.3.2  Vermehrung von Simianvirus 5

Simianvirus 5 (SV5) wurde auf MDBK-Zellen gezüchtet. Zunächst mußten die MDBK-Zellen in T175-Zellkulturflaschen (Nunc, Life Technologies, Deutschland) bei 37°C mit 5 % CO2 bis zur Konfluenz vermehrt werden. Das Wachstumsmedium bestand aus 95 % v/v DMEM und 5 % v/v FCS. Ein Tag vor der Virusinokulation wurden die Zellen auf Gewebekulturpetrischalen (∅  15 cm, Falcon, Biosciences Labware, Deutschland) umgesetzt. Zur Umsetzung wurde das Wachstumsmedium abgesaugt und die Zellschicht mit Trypsin/EDTA-Lösung gespült. Daraufhin erfolgte eine Zugabe von 4 ml Trypsin/EDTA-Lösung und die Flaschen wurden ca. 5 min bei 37°C inkubiert. Nach Ablösen der Zellen wurden 8 ml Wachstumsmedium zugegeben und die Zellen resuspendiert. Die Zellsuspension wurde 1:3 mit dem Wachstumsmedium verdünnt und auf die Petrischalen umgesetzt. Am nächsten Tag war die Zellschicht 90-95 % konfluent. Zur Beimpfung wurde das Wachstumsmedium abgenommen und die Zellschicht einmal mit DMEM gespült. Anschließend wurden die Zellen mit 2 ml virushaltiger DMEM-Suspension (0.1-0.3 pfu/Zelle) bedeckt. Nach einer einstündigen Inkubation bei RT wurden 18 ml Erhaltungsmedium (98 % v/v DMEM und 2 % v/v FCS) zugegeben. Die inokulierten Zellen wurden bei 37°C mit 5 % CO2 inkubiert. Am 3. Tag nach der Inokulation wurde das Erhaltungsmedium abgenommen.

3.3.3 Virusreinigung

Zur Reinigung der angezüchteten Viren wurde zunächst die Allantoisflüssigkeit bzw. das Erhaltungsmedium 30 min bei 1000 xg, 4°C zentrifugiert, um zelluläre Bestandteile abzutrennen. Durch eine Ultrazentrifugation bei 100 000 xg (1.5 h, 4°C) wurden die Virionen sedimentiert und anschließend in einem geringen Volumen PBS resuspendiert. Daraufhin wurden die Viren über einen diskontinuierlichen Saccharosegradienten (60 %, 40 %, 20 % w/v Saccharose in HNE-Puffer, pH 7.4: 5 mM HEPES, 150 mM NaCl, 0.1 mM EDTA) geschichtet und 16 h bei 100 000 xg, 4°C zentrifugiert. Die sichtbare Virusbande wurde abgenommen und im dreifachen Volumen PBS gewaschen (100 000 xg, 1h, 4°C). Zuletzt wurden die Viren in PBS aufgenommen und bei -70°C gelagert.


[Seite 31↓]

Die Proteinkonzentration der gereinigten Viren wurde nach der Methode von Lowry (1965) bestimmt. Zur Identifizierung der Viren wurde eine SDS-Polyacrylamidgelelektrophorese (SDS-PAGE) verwendet.

3.4 Isolierung und Identifizierung der viralen Fusionsproteine

3.4.1 Isolierung des Sendaivirus-F-Proteins

Diese Präparation wurde nach der Methode von Tomasi und Loyter (1981) mit Veränderungen nach Bagai et al. (1993) durchgeführt. Sendaiviren (20 mg Virusprotein) wurden in 4 ml Puffer A (20 mM Tris, pH 8.4, 150 mM NaCl, 3 mM DTT) resuspendiert und 2 h bei 37°C inkubiert. Danach erfolgte eine Dialyse der Suspension für 16 h bei 4°C gegen 2 l Puffer B (10 mM Tris, pH 7.4, 150 mM NaCl, 2 mM Ca2+ , 2 mM Mg 2+ ) , wobei der Dialysepuffer dreimal gewechselt wurde. Es wurde ein Dialyseschlauch mit einem MWCO von 12-14 kDa (Serva Electrophoresis GmbH, Heidelberg, Deutschland) verwendet. Die so behandelten Viren wurden 1 h bei 100 000 xg, 4°C zentrifugiert. Das erhaltene Pellet wurde in 2 ml Puffer B mit 2 % w/v Triton X-100 resuspendiert und 90 min bei RT geschüttelt. Durch eine Zentrifugation (1 h bei 100 000 xg, 4°C) wurde das Nukleokapsid sowie das reduzierte HN ausgefällt, und im Überstand erhielt man das F-Protein in der Detergenzphase. Durch eine schrittweise Zugabe von Bio-Beads SM2 (Bio-Rad Laboratories GmbH, München, Deutschland) zum Überstand konnte das Detergenz entfernt werden. Zuvor wurden die Bio-Beads SM2 nach den Angaben des Herstellers in Methanol und Aqua dest. gewaschen. 145 mg gewaschene Bio-Beads SM2 wurden zur Triton-F-Protein-Suspension zugegeben und 2 h bei RT leicht geschüttelt. Diese Inkubation mußte nach einer erneuten Zugabe von 145 mg Bio-Beads SM2 wiederholt werden. Anschließend wurden 290 mg Bio-Beads SM2 hinzugefügt und 2 h bei 4°C inkubiert. Zum Trennen der Bio-Beads SM2 wurde die Suspension mit Hilfe einer Kanüle aufgesaugt und nochmals zentrifugiert (1 h bei [Seite 32↓] 100 000 xg, 4°C). Die Aufnahme des Pellets erfolgte in 1 ml Puffer B. Die Proteinkonzentration wurde nach der Methode von Bradford (1976) bestimmt und betrug 0.5-0.8 mg/ml. Die Phospholipidmenge wurde, wie bei Böttcher et al. (1961) beschrieben, bestimmt, nachdem die Lipide nach der Methode von Bligh and Dyer (1959) aus den Virosomen extrahiert wurden.

Für die Rekonstitution des isolierten F-Proteins wurden 130 nmol Phosphatidylcholin aus Eigelb (Ei-PC) und 56 nmol Phosphatidylethanolamin-N-(lissamin-rhodamin-B-sulfonyl) (Rh-PE) benutzt. Zunächst wurde das Chloroform, worin die Lipide gelöst waren, unter Stickstoff abgedampft. Zum entstandenen Lipidfilm wurde die detergenzhaltige Proteinsuspension zugegeben und 15 min bei RT leicht geschüttelt. Das Detergenz wurde mittels Bio-Beads SM2 wie oben beschrieben entfernt. Die Entfernung von Triton X-100 wurde mittels Absorptionsmessung überprüft (siehe 3.4.3).

3.4.2 Isolierung der Glykoproteine des Simianvirus 5

Die Isolierung der SV5-Membranproteine basiert auf der Methode von Prehm et al. (1979) . Zunächst wurden 8 ml Viren (1 mg Virusprotein/ml) mit 100 µl Protease Inhibitor Cocktail 5 min bei RT inkubiert. Zur Virussuspension wurden dann 8 ml 1 M NaCl-Lösung sowie Triton X-100 (Endkonzentration 2 % w/v) zugegeben und 30 min bei RT geschüttelt. Es folgte eine 30 minütige Zentrifugation bei 100 000 xg, 4°C. Der Überstand wurde 4 h gegen 2 l Puffer I (5 mM NaAc, pH 4.5, 0.1 % w/v Triton X-100) bei 4°C dialysiert. Dabei wurde der Dialysepuffer jede Stunde gewechselt. Das Dialysat wurde, wie oben beschrieben, zentrifugiert und der Überstand auf eine mehrmals mit Puffer I gespülte Fetuin-Agarose-Säule (Sigma-Aldrich Chemie GmbH, Deisenhofen, Deutschland) aufgetragen. Die Affinitätssäule wurde wieder mit Puffer I gespült, wobei das HN an die N-Acetylneuraminidasesäure (NANA) des Fetuins gebunden und das F-Protein durchgespült wurde. Das HN wurde mit 150 mM NaCl im Puffer I eluiert. Die benutzte Säule wurde mit Puffer II (5 mM NaAc, 500 mM NaCl, 150 mM Glucuronicsäure) regeneriert. Die Affinitätssäulenchromatographie wurde bei 4°C durchgeführt. Danach wurde die Detergenzmenge in den Proteinsuspensionen bestimmt (siehe 3.5.3) und das Detergenz wie im Abschnitt 3.5.1 beschrieben durch eine schrittweise Zugabe von Bio-Beads SM2 entfernt. Es wurden 1 mg Bio-Beads SM2 auf 70 µg [Seite 33↓] Triton X-100 zugegeben. Die isolierten Proteine wurden mittels Centricon 100 nach der Angabe des Herstellers umgepuffert mit PBS (pH 7.4) und aufkonzentriert. Die Proteinkonzentration wurde nach der Methode von Bradford (1976) bestimmt und betrug 0.5-0.8 mg/ml.

3.4.3 Bestimmung der Tritonmenge

In den unterschiedlichen Etappen der Proteinisolierung und –rekonstitution wurde die Menge von Triton X-100 nach der Methode von Hrafnsdóttir und Menon (2000) bestimmt. Triton X-100 weist eine intensive Absorption bei einer Wellenlänge von 275 nm auf. Da aber die aromatischen Aminosäuren im Bereich um 200-280 nm absorbieren, müssen Proteine in der zu messenden Suspension entfernt werden. Zu je 150 µl Probe wurden 600 µl Methanol und 300 µl Chloroform zugegeben und intensiv gevortext. Dadurch werden die Proteine ausgefällt und Triton X-100 in Chloroform-Methanol-Gemisch gelöst. Die Proben wurden 5 min bei 13 500 xg zentrifugiert, um die ausgefällten Proteine zu pelletieren. Der Überstand wurde bei 275 nm mit einem UV-1202 Spektrometer (Shimadzu, Japan) vermessen. Die Tritonkonzentration konnte aus Meßwerten von gleich behandelten Standardproben berechnet werden.

3.4.4 SDS-PAGE

Zur Identifizierung der Virusproteine wurde die SDS-PAGE unter Verwendung eines Minigel-Systems (Bio-Rad Laborotories GmbH, München, Deutschland) durchgeführt. Je 50 µl Proben (1 mg Protein/ml) wurden mit je 12.5 µl Probenpuffer (0.5 M Tris, pH 6.8, 5 % SDS, 25 % Glycerol, 0.05 % Bromphenol blau) versetzt und 5 min bei RT inkubiert. Die Proben wurden auch unter reduzierenden Bedingungen behandelt. In diesem Fall enthielt der Probenpuffer 25 % ß-Mercaptoethanol, und die Proben wurden 3 min bei 95°C inkubiert. Pro Geltasche eines 10 %igen Polyacrylamidgels wurden jeweils 30 µl der entsprechenden Probenlösung aufgetragen.

Die Proteinbanden wurden mittels Coomassie- oder Silberfärbung visualisiert. Die [Seite 34↓] gefärbten Gele wurden mit einem Flachbett digitalisiert und mit Hilfe der Sigma-Scan Image Software ausgewertet.

3.4.5 Chemisches Crosslinking

Zur Untersuchung der Oligomerstruktur wurden isolierte F-Proteine mit dem homo-bifunktionalen Reagenz Dithiobissuccinimidylpropionat (DSP) kovalent verknüpft. Dazu wurden die Proben mit 0.3 mM DSP, das in Dimethylsulfoxid gelöst war, bei 4°C unterschiedlich lange inkubiert. Die Reaktion wurde durch eine Zugabe von 50 mM Glycin und anschließende Inkubation bei 4°C für 15 min gestoppt. Diese Proben wurden mittels SDS-PAGE mit einem 7.5 %igen Polyacrylamidgel unter nicht reduzierenden Bedingungen quantitativ analysiert.

3.4.6 Hämolysetest

Um zu überprüfen, ob die F-Proteine nach der Isolierung noch fusionsaktiv sind, wurde ein Hämolysetest durchgeführt. Humane Erythrozyten wurden dreimal mit PBS bei 2000 xg gewaschen und in PBS (Hk 2.5 %) resuspendiert. Zunächst wurden 500 µl Erythrozyten mit 50 µg F-Virosomen vermischt. Zu dieser Suspension wurde Weizenkeimagglutinin (WGA, wheat germ agglutinin) mit einer Endkonzentration von 8 µg/ml zugegeben und 30 min auf Eis inkubiert. Zur Induktion der F-vermittelten Hämolyse wurde die Virosomen-Erythrozyten-Suspension bei 37°C inkubiert und dabei periodisch geschüttelt. Nach bestimmten Zeiten wurden 50 µl Aliquots aus der Suspension entnommen und zu 1 ml eiskaltem PBS zugegeben, um die Hämolyse zu stoppen. Nach einer 5 minütigen Zentrifugation bei 13 000 xg wurde der Überstand bei 540 nm am UV-1202 Shimadzu-Spektrometer vermessen. Zur Berechnung der Hämolyse wurde die Freisetzung des gesamten Hämoglobins durch Triton-Zugabe erzielt. Dazu wurde der Überstand wieder zum Pellet gegeben, Triton X-100 (Endkonzentration 1 mM) zugegeben und intensiv gemischt. Danach erfolgte eine nochmalige Zentrifugation und Überstandsvermessung. Zur Kontrolle wurden Erythrozyten mit 25 µg Virosomen ohne WGA-Zugabe oder nur mit WGA inkubiert. [Seite 35↓] Sendaivirus bzw. SV5 induzierte Hämolyse wurde, wie oben beschrieben, durchgeführt, nur ohne WGA-Zugabe.

3.4.7 FDQ-Assay mit Sendaivirus-F-Virosomen

Zur Untersuchung der Fusionsaktivität des isolierten Sendaivirus-F-Proteins konnte ebenfalls der Fluoreszenzdequenching (FDQ)-Assay verwendet werden (siehe 3.5). Während der Rekonstitution wurde Rh-PE in die F-Virosomen eingebaut, und als Target wurden HepG2-Zellen verwendet. Als Vergleich diente die Fusion von Sendaiviren mit HepG2-Zellen. Die Viren wurden mit R18 markiert (siehe 3.5.1), da sich Rh-PE sehr schlecht in die Lipidhülle von Sendaiviren einbauen läßt.

3.4.7.1 Kultur der HepG2-Zellen

Die HepG2-Zellen wurden in mit Kollagen A beschichteten T75-Zellkulturflaschen (Nunc, Life Technologies, Deutschland) bei 37 C° mit 5 % CO2 gezüchtet. Das Kulturmedium bestand aus 90 % v/v DMEM und 10 % v/v hitzeinaktiviertem FCS. Für die spektroskopischen Messungen wurden die Zellen geerntet. Dazu wurde die Zellschicht einmal mit Trypsin/EDTA-Lösung gespült und ca. 10 min bei 37 C° mit 4 ml Trypsin/EDTA inkubiert. Danach wurden die Zellen in 8 ml Kulturmedium resuspendiert und 30 min bei 4 C° inkubiert. Die Zellen wurden zweimal mit eiskaltem PBS mit 2 mM Ca2+ und 2 mM Mg2+ (PBS+) gespült und anschließend in PBS+ (107  Zellen/ml) resuspendiert.

3.4.7.2 Fusionsmessung

Fluoreszenzmarkierte Virosomen oder Sendaiviren (50 µg bzw 40 µg Protein) wurden zu 1 ml HepG2-Zellen zugegeben und 40 min bei 4°C inkubiert. Um die nicht gebundenen Zellen zu trennen, wurde die Virosomen- bzw. Virus-Zell-Suspension zweimal mit PBS+ bei 300 xg gewaschen, und das Pellet in 300 µl PBS+ resuspendiert. 150 µl der Virosomen- bzw. Virus-Zell-Suspension wurden zu 1.85 ml PBS+ (pH 7.4 und 37°C) in einer Quarz-Küvette zugegeben, und die Änderung der Fluoreszenzintensität verfolgt. Um die endozytotische Aufnahme der Virosomen durch die Zellen zu verhindern, enthielt der Puffer in der Küvette [Seite 36↓] 20 mM NaN3 . Nach 45 min wurden 50 µl der Triton X-100-Stammlösung (20 % v/v) zugegeben, um maximales Fluoreszenzdequenching zu erreichen. Während der Messungen wurde die Temperatur mit Hilfe eines angeschlossenen Thermostaten konstant gehalten. Die Suspension in der Küvette wurde kontinuierlich mit einem teflonbeschichteten Magnetrührer gerührt. Die Fluoreszenz wurde bei einer Anregungswellenlänge von 560 nm und einer Emissionswellenlänge von 590 nm (cut-off Filter 570 nm, Zeitauflösung 1 sec) gemessen. Der FDQ-Wert wurde nach Formel 3.1 berechnet.

3.5 Fluoreszenzspektroskopische Messungen an Paramyxoviren

Die Fusionsaktivitäten der Viren wurden mittels eines SLM-AMINCO Serie 2

Fluoreszenzspektrometers (AMINCO-Bowman, Urbana, IL, USA) unter Verwendung des R18-Assays untersucht. Diese von Hoekstra et al. (1984) beschriebene Methode nutzt die selbstlöschende Eigenschaft des hydrophoben Membranmarkers Octadecylrhodamin-B-chlorid (R18). Bei hohen Konzentrationen des Markers tritt eine gegenseitige Behinderung der Fluoreszenzemission der benachbarten R18-Moleküle auf (self quenching). Wenn eine markierte Membran mit einer unmarkierten fusioniert, resultiert die Abnahme der Oberflächendichte des Markers in einem Anstieg der Fluoreszenzintensität (fluoreszenzdequenching). Dies ermöglicht kinetische und quantitative Messungen von Fusionsprozessen (Hoekstra et al.; 1984) . Für den R18-Assay wurde die Virushülle mit R18 markiert, und als Targetmembran wurden Erythrozyten-Ghosts verwendet.

3.5.1 Markierung von Viren mit R18

Zu 200 µl Sendaivirus bzw. Simianvirus 5 mit einer Virusproteinkonzentration von 1 mg/ml wurden 2 µl der R18-Stammlösung (2 mM R18 in Ethanol) gegeben und sofort gevortext. Anschließend wurde die R18-Virus-Suspension 30 min bei Raumtemperatur (RT) [Seite 37↓] im Dunkeln inkubiert. Zum Entfernen von nicht eingebauten R18-Molekülen wurde die Suspension 7 min bei 42 000 xg, 4°C zentrifugiert, der Überstand abgesaugt und das Pellet in 200 µl PBS resuspendiert.

3.5.2 Herstellung von offenen Erythrozyten-Ghosts

Diese Präparation wurde nach der von Dodge et al. (1963) beschriebenen Methode durchgeführt. Das Erythrozytenkonzentrat wurde dreimal mit PBS gewaschen (2000 xg, 10 min, 4°C) und in eiskaltem Hämolysepuffer I (5.8 mM NaH2 PO 4 /Na 2 HPO 4 ) resuspendiert. Nach einer Inkubation für 20 min bei 4°C wurde die Suspension 20 min bei 20 400 xg, 4°C zentrifugiert, das Sediment in eiskaltem Hämolysepuffer I resuspendiert und 10 min bei 4°C inkubiert. Danach erfolgte eine 10 minütige Zentrifugation bei 20 400 xg und 4°C. Die 10 minütige Inkubation und die anschließende Zentrifugation wurden so oft wiederholt, bis die Ghosts kein Hämoglobin mehr enthielten (farblos aussahen). Zum Schluß wurden die Ghosts mit 70 ml kaltem PBS gewaschen (10 min, 20 400 xg, 4°C). Zu den Ghosts wurde 0.02 % NaN3 zugegeben und diese bis zur weiteren Verwendung, jedoch nicht länger als 2 Wochen, im Kühlschrank aufbewahrt. Die Proteinkonzentration wurde nach der Methode von Lowry (1951) bestimmt und betrug 4-6 mg Protein/ml.

3.5.3 Fusionsassay und Datenanalyse

Für die meisten spektroskopischen Messungen mußten zunächst die markierten Viren an die Targetmembran gebunden werden. Dazu wurden 20 µl Viren zu 50 µl Ghosts zugegeben und 30 min bei 4 C° inkubiert. Für einige Versuche wurden 20 µl der R18-markierten Viren direkt in die Küvette mit einer Suspension von 1.93 ml PBS (37°C, pH 7.4) und 50 µl Ghosts zugegeben. Falls nicht anders angegeben, wurden 70 µl der Virus-Ghost-Suspension zu 1.93 ml PBS, pH 7.4 mit voreingestellter Temperatur in einer Quarz-Küvette gegeben. Bei Untersuchung der pH-Abhängigkeit wurde bei den pH-Werten von 4.5 bis 6.0 NaAc-Puffer verwendet und bei 37°C gemessen. Vor dem Ende jeder Messung (bei 3500 sec) wurde durch Zugabe von 50 µl einer Triton X-100-Stammlösung (20 % v/v) eine unendliche Verdünnung [Seite 38↓] der Fluoreszenzprobe R18 und damit deren maximale Fluoreszenzintensität erreicht. Während der Messungen wurde die Temperatur mit Hilfe eines angeschlossenen Thermostaten konstant gehalten. Die Suspension in der Küvette wurde kontinuierlich mit einem teflonbeschichteten Magnetrührer gerührt. Die Messung der Fluoreszenz erfolgte jeweils 1 Stunde bei einer Anregungswellenlänge von 560 nm und einer Emissionswellenlänge von 590 nm (cut-off Filter 570 nm, Zeitauflösung 1 sec).

Das Ausmaß des Fluoreszenzdequenchings (FDQ) als Maß für die Fusionsausbeute wurde nach der von Blumenthal et al. (1987) beschriebenen Formel berechnet:

 

(3.1)

wobei F(0) bzw. F(t) die Fluoreszenzintensität der R18-Virus-Ghost-Suspension am Anfang der Messung bzw. nach t sec Messung, F(max) die Fluoreszenzintensität nach Tritonzugabe darstellt.

3.6 Überprüfung des Lysolipideinflusses auf die Fusion von Myxoviren sowie die Untersuchung der Wechselwirkung von Lysolipiden mit Influenzaviren

3.6.1 Untersuchung der Sendaivirus-Ghost-Fusion in Anwesenheit von Lysolipiden

Für die Untersuchung des Einflusses von Lysolipiden auf die Sendaivirus-Ghost-Fusion wurde R18-Assay verwendet (siehe 3.5), und die Sendaiviren wie im Abschnitt 3.5.1 beschrieben mit R18 markiert. Zunächst wurden entsprechenden Mengen an Lysophosphatidylcholin (LPC) zu 50 µl Ghosts in 1.93 ml PBS, pH 7.4 und 37°C, in einer Quarz-Küvette gegeben und 4 min inkubiert. Danach erfolgte eine Zugabe von 20 µl R18-markierten Sendaiviren in die Küvette. Die Fusion von Sendaiviren mit Ghosts wurde über [Seite 39↓] einen Zeitraum von 1 h verfolgt, und am Ende der Messung 50 µl einer 20 %igen Triton-X-100-Lösung zugegeben, um eine unendliche Verdünnung des Fluoreszenzmarkers zu erreichen. Weitere Angaben zur Fusionsmessung und Analyse der Meßdaten sowie zur Geräteeinstellung siehe Abschnitt 3.5.

3.6.2 Fusionsanalyse von Influenzaviren mit Ghosts in Anwesenheit von Lysolipiden

Die Fusion von Influenzaviren mit Ghosts in Anwesenheit von Lysolipiden wurde mittels R18-Assays untersucht (siehe 3.5) Dazu war zunächst die Markierung der Influenzaviren mit R18 und eine anschließende Bindung an Ghosts notwendig. Zu 250 µl Influenzavirus mit einer Virusproteinkonzentration von 1 mg/ml wurden 1.25 µl der R18-Stammlösung (2 mM R18 in Ethanol) gegeben und sofort gevortext. Nach einer Inkubation für 30 min bei Raumtemperatur im Dunkeln, wurden die nicht eingebauten R18-Moleküle durch eine 7 minütige Zentrifugation mit 42 000 xg getrennt, und das Pellet in 250 µl PBS resuspendiert. Zu den 250 µl R18 markierten Viren wurden 500 µl offene Erythrozyten-Ghosts (siehe 3.5.2.) zugegeben und 30 min auf Eis inkubiert.

Für die Messung der Fusion erfolgte eine Zugabe von 30 µl der Virus-Ghost-Suspension zu 1.97 ml NaAc-Puffer, 37°C und pH 7.4, in einer Quarz-Küvette. Sechzig Sekunden nach dem Beginn der Messung wurden entsprechende Mengen an Lysophosphatidylcholin (LPC) oder spinmarkiertes LPC (spinlabeled LPC; SL-LPC) in die Küvette gegeben und 4 min inkubiert. Die Fusion wurde durch eine Erniedrigung des pH-Wertes der Suspension auf 5.0, die durch das Einspritzen von 17-22 µl 0.25 M Zitronensäure erreicht wurde, induziert. Um eine unendliche Verdünnung der Fluoreszenzprobe R18 und damit deren maximale Fluoreszenzintensität (Fmax) zu erreichen, wurden 50 µl einer 20 %igen Triton-Stammlösung 800 sec nach Beginn der Messung zugegeben.

Die Änderung der Fluoreszenzintensität wurde mittels eines SLM-AMINCO Serie 2 Fluoreszenzspektrometers (AMINCO-Bowman, Urbana, IL, USA) mit einer Zeitauflösung von 0.5 sec verfolgt. Die Geräteeinstellungen entsprachen den Angaben im Abschnitt 3.5.4. Der FDQ-Wert wurde nach der Formel (3.1) berechnet, wobei F(0) und F(t) die [Seite 40↓] Fluoreszenzintensität der Virus-Ghost-Suspension vor dem Auslösen der Fusion bzw. danach zum Zeitpunkt t darstellt.

3.6.3 Präparation von Bromelain-behandelten Influenzaviren und Bromelain-gespaltener HA-Ektodomäne

Die Abspaltung der HA-Ektodomäne durch Bromelain wurde nach der Methode von Brand und Skehel (1972) mit einigen Änderungen nach Harter et al. (1989) durchgeführt. Die gereinigten Influenzaviren wurden in 0.1 M Tris-Puffer (pH 7.2) mit 1 mM EDTA resuspendiert und nach Zugabe von 50 mM ß-Mercaptoethanol mit Bromelain (Virusprotein/Enzym 1:1 w/w) inkubiert. Nach 16 h Inkubation bei 37°C wurden die behandelten Viren 1 h bei 100 000 xg und 4°C pelletiert. Das Pellet wurde in PBS gewaschen, resuspendiert und bis zur weiteren Verwendung bei –20°C aufbewahrt.

Um BHA zu isolieren, wurde der Überstand mittels Affinitätssäulenchromatographie nach Doms et al. (1985) gereinigt. Der Überstand wurde auf eine Ricinsäule (immobilisiertes Agglutinin RCA120 aus Ricinus Communis, Sigma-Aldrich Chemie GmbH, Deisenhofen, Deutschland) aufgetragen und für 15 min inkubiert. Das gebundene BHA wurde mit Galactose als kompetetiven Zucker von der Säule eluiert. Die Galactose wurde durch eine Dialyse für 14 h gegen PBS entfernt. Dabei wurde der Dialysepuffer einmal gewechselt. Die Reinheit der isolierten BHA wurde mittels einer SDS-PAGE unter reduzierenden Bedingungen überprüft. Die Proteinkonzentration wurde nach der Methode von Lowry (1951) bestimmt.

3.6.4 Bindung von bis-ANS an BHA und Influenzaviren

Mittels bis-ANS-Assay wurde getestet, ob die isolierten BHA-Moleküle intakt sind, d.h. ob sie im sauren Milieu ihre Konformation ändern. Der Einsatz des Fluoreszenzmarkers bis-ANS (1,1‘-bis(anilino)-naphtalen-5,5‘-disulfonsäure) ermöglicht Aussagen über die Freilegung hydrophober Bindungsstellen und damit über die Konformationsumwandlung von HA bzw. BHA (Korte und Herrmann, 1994; Korte et al. 1999). Die Fluoreszenzintensität der [Seite 41↓] bis-ANS-Moleküle ist stark von der Umgebung abhängig, wobei die Quantenausbeute in einer polaren Umgebung z.B. Wasser sehr gering ist. Bis-ANS kann nichtkovalent an hydrophobe Bindungsstellen von Lipiden und Proteinen binden. Dies führt zur Abnahme der Polarität der Umgebung und zu einer Erhöhung der Fluoreszenzintensität.

Für die Versuche wurde eine 1 mM bis-ANS Stammlösung in Methanol angesetzt. Zu 2 ml NaAc-Puffer, pH 7.4, wurden 1 nmol bis-ANS und nachfolgend BHA (Endkonzentration 5 µg/ml) oder Influenzavirus (HA-Endkonzentration 5 µg/ml; 25 % der viralen Proteine sind HA) zugegeben. Zur Erniedrigung des pH-Wertes auf 5.0, womit die Konformationsänderung von BHA/HA ausgelöst wird, wurden entsprechende Mengen von 0.25 M Zitronensäure in die Küvette eingespritzt. Während der Messungen wurde die Temperatur mit Hilfe eines angeschlossenen Thermostaten bei 37°C konstant gehalten. Die Suspension in der Küvette wurde ständig mit einem teflonbeschichteten Magnetrührer gerührt. Die Änderung der bis-ANS-Fluoreszenzintensität wurde bei einer Anregungswellenlänge von 400 nm und einer Emissionswellenlänge von 490 nm mit einer Zeitauflösung von 0.5 sec gemessen.

Die relative Fluoreszenzintensität (Irel) wurde nach der Formel (3.2.) berechnet:

 

(3.2)

wobei I(t) die gemessene bis-ANS-Fluoreszenzintensität zum Zeitpunkt t, I(0) und I(7.4/max) die Fluoreszenzintensität von bis-ANS in wäßriger Lösung bzw. in Anwesenheit von BHA/HA bei pH 7.4 darstellt.

3.6.5 Herstellung von SUVs

Für die Herstellung von SUVs (small unilamellar vesicles) wurden 3 mol Ei-PC in einer Chloroformlösung in ein Glasröhrchen gegeben und das Lösungsmittel unter Stickstoff abgedampft. Die Lipide wurden in 500 µl PBS (pH 7.4) resuspendiert und anschließend 10 min mit Hilfe des Branson Sonifiers Model W250 (Carouge-Geneve, Schweiz) im Eisbad mit Ultraschall (Output 2, Duty Cycle 50 %) beschallt.


[Seite 42↓]

3.6.6  ESR-Messungen

Für die ESR-Messungen wurde spinmarkiertes Lysophosphatidylcholin (SL-LPC, C18), gelöst in Chloroform, verwendet. Entsprechende Mengen von SL-LPC wurden in ein Reagenzglas gegeben und das Lösungsmittel unter Stickstoff abgedampft. Die Lysolipide wurden in 10 μl PBS durch vorsichtiges Vortexen angelöst. Für die Untersuchung der Wechselwirkung von SL-LPC mit BHA wurden 100 µl BHA (1 mg/ml) zu 6.3 nmol SL-LPC in PBS zugegeben, wobei das molare Verhältnis von BHA-Monomeren zu SL-LPC ~1:1.5 entsprach. Für die Messung der SL-LPC-Virus-Wechselwirkung wurden jeweils 100 µl natives oder Bromelain-behandeltes Virus (beide 1 mg Virusprotein/ml) zu 3 nmol SL-LPC in PBS hinzugefügt. Wenn man berücksichtigt, daß bei Influenzaviren 75 % des Gesamtgewichts Proteine ausmachen und den Rest Lipide, entsprechen die Molverhältnisse von endogenen Viruslipiden sowie HA-Monomeren (2.5 x 1012 Virionen/mg Virusprotein, 500 Trimere/Virion (Korte und Herrmann, 1994; Klenk, 1991) zu den SL-LPC-Molekülen 10:1 bzw. 1:5. Für die Messungen in Anwesenheit von Liposomen wurden 5.25 µl SUVs zu 3.15 nmol SL-LPC zugegeben (Ei-PC:SL-LPC = 10:1 mol/mol). Zu dieser Suspension wurden dann 50 µl BHA (1 mg/ml; BHA-Monomer:SL-LPC = 1:5 mol/mol) zugegeben. Um den pH-Wert der einzelnen Suspensionen auf 5.0 zu erniedrigen, wurden entsprechende Mengen von 0.25 M Zitronensäure zugegeben. Die ESR-Spektren wurden innerhalb 1 min nach pH-Erniedrigung aufgenommen.

Die ESR-Spektren der Proben wurden mit einem Bruker ECS 106 Spektrometer (Bruker, Karlsruhe, Deutschland) bei 37°C verfolgt und mit einem vom Gerätehersteller bereitgestellten Software analysiert. Für ein Spektrum wurden jeweils 8 Scans akkumuliert. Die Meßparameter waren folgende: Modulationsamplitude 4 G und Scanbreite 100 G.


[Seite 43↓]

3.7  Fluoreszenzmikroskopische Studien an exprimiertem Sendaivirus-F-Protein und dessen Chimären

3.7.1 Das pTM1/vTF7-3 Expressionssystem

Zur Expression des Sendaivirus-F und dessen Chimären auf CV1-Zellen wurde das pTM1/vTF7-3 Expressionssystem verwendet. Dieses System besteht aus folgenden Komponenten: dem Expressionsplasmid pTM1, welches das zu exprimierende Gen unter Kontrolle des T7 φ 10-Promotors enthält, sowie dem rekombinanten Vakziniavirus vTF7-3, das die T7-RNA-Polymerase exprimiert. Die T7-RNA-Polymerase ist äußerst spezifisch für T7-Promotoren und hat eine hohe Transkriptionsaktivität. Nach Infektion einer Zelle mit dem rekombinanten Virus kommt es zum Erliegen der zellulären Proteinsynthese, und es werden ausschließlich virale Gene und damit auch die T7-RNA-Polymerase exprimiert. Damit steht eine ausreichende Menge an Polymerase zur effizienten Transkription des durch nachfolgende Transfektion in die Zelle eingebrachten T7-Expressionsplasmids zur Verfügung. Die Vakziniavirusinfektion führt aber zu einem starken zytopathischen Effekt und damit zum Zelltod, daher ist eine dauerhafte Expression nicht möglich.

3.7.1.1 Zu exprimierende Proteine und deren Plasmide

In der vorliegenden Arbeit wurden der Wildtyp des Sendaivirus-F (Fwt) (Stamm Z) und dessen Chimären: FFH, FHF, FHH, F4F, F44 exprimiert. Bei den Chimären FFH, FHF und FHH wurde die transmembranale und/oder zytoplasmatische Domäne durch die äquivalenten Domänen des Influenzavirus-A-HA (Subtyp H7) ersetzt. Bei den Chimären F4F und F44 wurde die transmembranale bzw. transmembranale und zytoplasmatische Domäne durch die äquivalenten Domänen des membranständigen Proteins CD4 ersetzt. In der Tabelle 3.1 ist ein Übersicht über die Bezeichnung und Zusammensetzung der verwendeten Proteine gegeben. Die Aminosäuresequenzen der entsprechenden transmembranalen und zytoplasmatischen Domänen wurden in der Abbildung 3.6.1 angegeben.

Tab. 3.1:Zusammensetzung und Bezeichnung der untersuchten Proteine. Fwt (F-Wildtyp) entspricht dem Fusionsprotein eines nativen Sendaivirus (SeV-F). Bei den Chimeren FFH, FHF, FHH, F4F und F44 wurden transmembranale und/oder zytoplasmatische Domänen durch die äquivalenten Domänen des Influenzavirus A Hämagglutinins (HA) oder des membranständigen Proteins CD4 ersetzt.

Bezeichnung

Ektodomäne

Transmembranale Domäne

Zytoplasmatische Domäne

Fwt

SeV-F

SeV-F

SeV-F

FFH

SeV-F

SeV-F

HA

FHF

SeV-F

HA

SeV-F

FHH

SeV-F

HA

HA

F4F

SeV-F

CD4

SeV-F

F44

SeV-F

CD4

CD4

 

Transmembranale Domäne

SeV-F:

TVITIIVVMVVILVVIIVIIIVL (23 AS)

HA:

VILWFSFGASCFLLLAIAMGLVFICV (26 AS)

CD4:

ALIVLGGVAGLLLFIGLGIFFCV (23 AS)

 

Zytoplasmatische Domäne

SeV-F:

YRLRRCMLMCNPDERIPRDTOTLEPKIRHMOTNGGFDAMAEKR-COOH

(43 AS)

HA:

KNGNMRCTICI-COOH (11 AS)

CD4:

RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI-COOH (38 AS)

Die Gene des Fwt oder der jeweiligen F-Chimären wurden in den Expressionsvektor pTM1 einkloniert. Die Konstruktion der Chimären und die Einklonierung der Gene wurden von Dr. E. Ponimaskin und C. Weber vom Institut Immunologie und Molekulare Biologie, [Seite 45↓] Freie Universität Berlin, durchgeführt. Auch die Etablierung der Proteinexpression und die Überprüfung der Expression mittels Immunfällung und FACScan wurden von ihnen durchgeführt. Die Oberflächenexpression des Fwt und dessen Chimären waren vergleichbar (Ponimaskin und Schmidt, 1998; Weber, Ponimaskin und Schmidt, persönliche Mitteilung).

In jedem Expressionsansatz von den Fwt bzw. F-Chimären wurde zusätzlich der Wildtyp des Sendaivirus-HN-Proteins (Stamm Z) co-exprimiert. Die cDNA des HN wurde freundlichst von Dr. A. Portner, St. Jude Children’s Research Hospital, Memphis, zur Verfügung gestellt. Die HN-cDNA war ebenfalls in den Expressionsplasmid pTM1 einkloniert.

3.7.1.2 Transformation der Bakterienzellen

Die verwendeten Plasmide wurden in Bakterienzellen gezüchtet. Dazu mußten zunächst die Bakterienzellen mit den entsprechenden DNA transformiert werden. Für jede Plasmidprobe wurden 300 µl der kompetenten E. coli-Suspension vorbereitet. Je 10 ng Plasmidprobe wurden mit Aqua dest. auf 100 µl aufgefüllt und zur Bakteriensuspension hinzugefügt. Das DNA-Bakterien-Gemisch wurde 40 min auf Eis inkubiert und anschließend einem Hitzeschock im Wasserbad bei 42°C für 45 sec ausgesetzt. Die transformierten Zellen wurden mit je 600 µl YT-Medium (ohne Ampicillinzugabe) versetzt und 1 h bei 37°C geschüttelt. Um die tatsächlich transformierten Bakterien von den nicht transformierten zu trennen, wurden sie auf Agar-Platten mit Ampicillin ausgestrichen. Da die verwendeten Plasmide das Resistenz-Gen gegen Ampicillin enthalten, überleben auf diesen Platten nur die transformierten Bakterien. Nach einer Inkubation der Platten über Nacht bei 37°C wurden je vier einzelne, scharf abgegrenzte Bakterienkolonien pro Platte ausgewählt. Diese wurden nun in 3 ml YT-Medium mit Ampicillin (Endkonzentration 50 mg/l) weiter gezüchtet (ca. 18 h bei 37°C). Nach einer DNA-Mini-Präparation mit Hilfe eines QIAGEN Plasmid Mini Kits (Qiagen GmbH, Hilden, Deutschland) wurden die isolierten F-Plasmide mittels Agarose-Gelelektrophorese identifiziert.

3.7.1.3 Anlegen einer Glycerolkultur

Aus den transformierten Bakterien, die bei der elektrophoretischen Analyse eine zufriedenstellende DNA-Identifikation ergaben, wurden zur Aufbewahrung über längere [Seite 46↓] Zeiträume Glycerolkulturen angelegt. In glycerolhaltigem Medium lassen sich Bakterien bei tiefen Temperaturen sehr lange lagern, ohne daß ihre Vitalität verlorengeht. Je 700 µl der Bakterienkultur aus der Anzucht für die Mini-Präparation wurden mit je 500 µl sterilem Glycerol gemischt und bei –80°C aufbewahrt.

3.7.1.4 Plasmidzucht und –reinigung

Zum Erhalt einer größeren Menge an DNA wurden 100 µl der Glycerolkultur (auf Eis aufgetaut) zu 100 ml YT-Medium mit Ampicillin (Endkonzentration 50 mg/l) zugegeben und über Nacht bei 37°C geschüttelt. Die Aufreinigung der Plasmide erfolgte mittels QIAfilter Plasmid Maxi Kits (Qiagen GmbH, Hilden, Deutschland) nach der Anleitung des Herstellers. Die Menge der gereinigten DNA wurde mittels UV-VIS-Spektroskopie bei 260 nm bestimmt.

3.7.1.5 Transfektion von CV1-Zellen

CV1-Zellen wurden in DMEM mit einem Zusatz von 5 % v/v FCS bei 37 C° mit 5 % CO2 gezüchtet. Zirka 80 % konfluente Zellmonolayer in ∅  3.5 cm Petrischalen (Nunc, Life Technologies, Deutschland) wurden zweimal mit DMEM gewaschen, mit rekombinanten Vakziniaviren vTF7-3 (10 PFU/Zelle) infiziert und 1 h bei 37°C mit 5 % CO2 inkubiert. In der Zwischenzeit wurden die Plasmide für die Transfektion vorbereitet. Je Transfektionsansatz wurden, falls nicht anders angegeben, 3 µg cDNA des Fwt bzw. einer F-Chimäre und 6 µg cDNA des HN auf 100 µl mit DMEM verdünnt, sowie 10 µl Lipofectin mit 90 µl DMEM vermischt. Beide Suspensionen wurden 30 min bei RT inkubiert. Dann wurden diese Suspensionen vereinigt, vorsichtig vermischt und für weitere 15 min bei RT inkubiert. Von den zu transfizierenden Zellen wurde das Virusinokulum entfernt, und die Zellmonolayer einmal mit DMEM gewaschen. Die Transfektionslösungen wurden auf 1 ml mit DMEM verdünnt und auf die Zellen gegeben. Die Zellen wurden über Nacht bei 32°C mit 5 % CO2 inkubiert.


[Seite 47↓]

3.7.2  Untersuchung der Zell-Zell-Fusion

3.7.2.1 Markierung von Erythrozyten mit R18 und Calcein-AM

Bei dieser Präparation wird die Plasmamembran der Erythrozyten (RBC: red blood cells) mit hydrophobem R18 und das Zytosol mit hydrophilem Calcein-AM markiert. Zuerst wurde das humane Erythrozytenkonzentrat dreimal mit PBS gewaschen (10 min, 2000 xg, 4°C) und auf Hk 2 verdünnt. Zu 5 ml dieser Suspension wurden 20 µl R18 (2 mM in Ethanol) unter Vortexen zugegeben und 30 min bei RT im Dunkeln inkubiert. Um nicht eingebautes R18 zu absorbieren, wurde 25 ml DMEM mit 5 % v/v FCS zugegeben und 20 min bei RT inkubiert. Die Suspension wurde 10 min bei 4°C, 2000 xg zentrifugiert, und der Überstand entfernt. Die RBC wurden einmal mit PBS gewaschen und in 2 ml PBS aufgenommen. Dazu wurden 50 µl Calcein-AM (1 mM in DMSO) zugegeben und 45 min bei 37°C inkubiert. Das Calcein-AM diffundiert durch die Membran ins Zytosol und wird dort von zelleigenen Esterasen zu Calcein gespalten, welches fluoresziert und nicht mehr durch die Plasmamembran diffundieren kann. Die Erythrozyten wurden 2 mal mit PBS gewaschen (10 min, 2000 xg, 4°C) und wieder bei 37°C, 20 min inkubiert. Es erfolgte dreimaliges Waschen mit PBS. Zuletzt wurden sie mit PBS+ gewaschen und in 5 ml PBS+ resuspendiert. Die markierten RBC konnten bei 4°C bis zu 3 Tage gelagert werden.

3.7.2.2 Doppelmarkierung der HepG2-Zellen

Die HepG2-Zellen wurden wie die Erythrozyten mit R18 und Calcein markiert. Dazu wurden 3 ml einer HepG2-Zellsuspension (107  Zellen/ml, Vorbereitung der Zellsuspension siehe 3.5.7.1) verwendet. 20 µl R18 (2 mM in Ethanol) wurden zu den Zellen unter vorsichtigem Schütteln zugegeben. Nach 30 min Inkubation bei RT im Dunkeln wurden 10 ml eiskaltes DMEM mit 5 % FCS zugegeben und 15 min bei 4°C inkubiert. Die Zellen wurden einmal mit PBS+ gewaschen (5 min bei 4°C, 380 xg) und mit 30 µl Calcein-AM (1 mM in DMSO) versetzt. Nach einer Inkubation bei 37°C für 30 min wurden die Zellen dreimal 5 min bei 380 xg und 4°C mit PBS+ gewaschen und noch einmal bei 37°C, diesmal aber für 20 min inkubiert. Zum Schluß wurden Zellen wieder dreimal mit PBS+ gewaschen. Die Zellen wurden in 3 ml PBS+ resuspendiert und am gleichen Tag verwendet.


[Seite 48↓]

3.7.2.3  Vorbereitung der Expressionszellen und Bindung der Targetzellen

Die transfizierten CV1-Zellen (siehe 3.7.4) müssen zunächst einer Neuraminidase- und Trypsinbehandlung unterzogen werden. Durch die Neuraminidase werden die zelleigenen Sialinsäurereste verdaut, um eine Wechselwirkung der exprimierten HN-Moleküle mit diesen Rezeptoren zu unterbinden und eine bessere Bindung der Targetzellen an die Expressionszellen zu gewährleisten. Das Trypsin spaltet die exprimierten F-Moleküle in die fusionsaktive Form F1+F2. Dazu wurden die Zellmonolayer vom Nährmedium befreit und zweimal mit PBS+ gespült. Auf die Petrischalen wurden je 1 ml PBS+ mit 1 U Neuraminidase und 10 µg Trypsin zugegeben. Nach einer Inkubation von 15 min bei RT wurde der Puffer verworfen, und die Zellen wurden dreimal mit frischem PBS+ gespült.

Die Bindung der Targetzellen an die Expressionszellen erfolgte im Dunkeln und unter gelegentlichem Schwenken der Petrischalen. Es wurden je 1 ml der markierten Erythrozyten (oder 500 µl HepG2-Zellen) zugegeben und 60 min auf Eis inkubiert. Die nicht gebundenen Targetzellen wurden durch mehrmaliges Waschen mit gekühltem PBS+ entfernt. Zum Schluß wurde 1 ml PBS+ auf den Zell-Erythrozyt-Komplex gegeben, und die Zellen wurden auf Eis aufbewahrt.

3.7.2.4 Fluoreszenzmikroskopie

Zunächst wurde eine Aufnahme von den jeweiligen Zell-Zell-Komlpexen vor dem Fusionsvorgang gemacht, um die Bindung der markierten Zellen zu überprüfen und ein Vergleichsbild für den Fusionsprozeß zu haben. Die Zell-Zell-Fusion wurde durch eine Erhöhung der Umgebungstemperatur auf 37°C induziert. Nach 15 min Inkubation im Brutschrank (37°C) wurden die Zellen wieder mikroskopisch untersucht. Dabei wurde der Übergang der einzelnen Fluorophore kontrolliert. Der Fusionsprozeß wurde nach weiteren Inkubationen bei 37°C im Abstand von 15 min beobachtet.

Die fluoreszenzmikroskopischen Studien wurden bei RT mit einem Mikroskop Axiovert 100 (Carl Zeiss, Deutschland) unter Verwendung eines 40 x Objektivs (LD Achroplan) durchgeführt. Die eingesetzten Fluorophore wurden mit folgenden Einstellungen betrachtet: Rhodamin – 510-560 nm BP-Anregungsfilter/ 590 nm LP-Emissionsfilter, Calcein – 450-490 nm Anregungsfilter/ 520 nm LP-Emissionsfilter. Die Aufnahme der Bilder erfolgte mit der MC 80 Mikroskopkamera auf Kodak Ektachrome P 3200 ASA Farbfilm.


© Die inhaltliche Zusammenstellung und Aufmachung dieser Publikation sowie die elektronische Verarbeitung sind urheberrechtlich geschützt. Jede Verwertung, die nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung. Das gilt insbesondere für die Vervielfältigung, die Bearbeitung und Einspeicherung und Verarbeitung in elektronische Systeme.
DiML DTD Version 3.0Zertifizierter Dokumentenserver
der Humboldt-Universität zu Berlin
HTML-Version erstellt am:
08.12.2003