D Ergebnisse

↓48

D.1 Expression und Isolierung des S-Proteins von SARS-CoV und des humanen Rezeptors hACE2

Das S-Protein von SARS-CoV wird mittels eines optimierten Expressionssystems in HEK293T Zellen exprimiert. Zur Untersuchung der Wechselwirkung des SARS-CoV S-Proteins mit dem humanen Rezeptor hACE2 [156] wird ACE2 im selben Zelltyp exprimiert. Drei Varianten des viralen Fusionsproteins wurden exprimiert und analysiert: (1) zwei Volllängenvarianten (S-Full) und (2) eine verkürzte Variante ohne Transmembrandomäne (S-Ekto). Die S-Ekto-Variante wird in das Zellmedium sezerniert und anschließend über den C-terminalen (His)6 -Tag isoliert und aufgereinigt. Nach Dialyse beider Varianten wurden die Proteinkonzentrationen, die Reinheit und die Größe bestimmt. Der Rezeptor ACE2 wurde ebenfalls als Volllängen- (ACE-Full) oder verkürzte Variante (ACE2-Ekto) exprimiert. Die Isolierung erfolgte mittels Immunopräzipitation. Ziel der Aufreinigung war die Isolierung beider Proteine in hochreiner Form, um anschließend eine kryoelektronenmikroskopische 3D-Strukturanalyse durchzuführen.

D.1.1 Optimierung der Expressionsbedingungen

Zur Optimierung der Bedingungen für die Expression und Anreicherung der entsprechenden Proteine wurden zunächst verschiedene Transfektionsbedingungen und Zelltypen getestet.

↓49

Abbildung 8 : Optimierung der Transfektionsbedingungen für die Expression von S- und ACE2-Protein. (A und B) Vergleich der Transfektionsbedingungen von S-Ekto. Expression in zwei verschiedenen Zellsystemen mit verschiedenen Transfektionsreagenzien (PF und DF) und unterschiedlichen Infektionsbedingungen (+VV/-VV). Abkürzungen: VV-rekombinantes Vakziniavirus - VTF7.3; +VV-mit Infektion; -VV – ohne Infektion, PF – PolyFect; DF – DreamFect (siehe Material und Methoden und Text).

Um eine zu starke Cytotoxizität zu vermeiden wurden ferner verschiedene Verdünnungen des rekombinanten Vakziniavirus VTF7.3 (VV) getestet. VeroE6 und HEK293T Zellen unterschieden sich sehr deutlich im Expressionsmuster des S-Proteins von SARS-CoV. VeroE6 Zellen exprimierten eine relativ geringe Konzentration an S-Ektoprotein (Abbildung 8 A – Spuren 2,3,5 und 6). HEK293T Zellen dagegen zeigten eine deutlich höhere Ausbeute (Abbildung 8 A – Spuren 8, 9, 11 und 12). Die Inkubationszeit spielte für die jeweiligen Expressionsraten eine untergeordnete Rolle. Die Inkubation für 24 oder 48 h zeigte keine wesentlichen Unterschiede im Expressionsniveau. Als effektivste Transfektionsmethode für das S-Protein von SARS-CoV stellte sich die Transfektion mit DreamFect (DF) heraus (Abbildung 8 B – Spuren 3-7). Auch ohne Infektion der Zellen mit VTF7.3 konnten hohe Konzentrationen an Protein gewonnen werden. Nachhaltig verbessert wurde dieser Effekt durch den Einsatz des VTF7.3 Virus (Abbildung 8 B – Spur 5). Eine zweite Ernte war möglich und erlaubte eine, wenn auch geringere, Proteinausbeute (Abbildung 8 B – Spuren 6 und 7). Im Vergleich dazu war es unter Verwendung von PolyFect (PF) zwingend notwendig die Zellen mit VTF7.3 zu infizieren, da diese sonst lediglich eine geringe Proteinausbeute zeigten (Abbildung 8 B – Spur 2). Die Ausbeute nach der Infektion war vergleichbar mit der nach Transfektion mit DreamFect allein (Abbildung 8 B - Spur 1).

D.1.2 Expression und Aufreinigung des S-Proteins von SARS-CoV

Die Isolierung und Aufreinigung des S-Proteins erfolgte über den C-terminalen (His)6-Tag. Die Ektodomäne des Proteins wurde in das Medium sezerniert, konzentriert und anschließend über NiNTA-Agarose aufgereinigt. Mittels eines Imidazolstufengradienten wurde das gebundene Protein eluiert (siehe Material und Methoden). Um das überschüssige Imidazol zu entfernen, wurden die Proteinproben anschließend dialysiert und erneut konzentriert. Dies war notwendig, da Imidazol bei den elektronenmikroskopischen Untersuchungen stören würde. 

↓50

Das Elutionsprofil der Aufreinigung der His-getaggten Variante der Ektodomäne des S-Proteins wurde über Westernblot analysiert. Das Elutionsoptimum lag bei einer Konzentration von 300 mM Imidazol (Abbildung 9 A, E3). Um sicher zu stellen, dass das Protein vollständig eluiert vorliegt, wurde im weiteren Verlauf der Experimente bei einer Konzentration von 500 mM Imidazol eluiert. Im NiNTA Pellet konnte nachweislich kein Protein detektiert werden (Abbildung 9 A, NiNTA). Um das Imidazol zu entfernen, wurden die Proben anschließend für mehrere Stunden gegen Na-Acetat Puffer (pH 7.4) dialysiert und konzentriert. Proteinkonzentrationen von 2-3 mg/ml konnten nach Aufreinigung von mehreren 100 ml Medium erzielt werden. Die Monomere des S-Proteins wurden über ein reduzierendes Proteingel analysiert (Abbildung 9 B). Die obere Bande entspricht vermutlich der glykosylierten (glyk) Form des S-Proteins mit einem Molekulargewicht (MW) von ca. 200 kDa, wogegen die untere Bande mit einem MW von 180 kDa der nicht glykosylierten (nicht-glyk) Form entspricht (Abbildung 9 B).

Abbildung 9: Proteinanalyse der S-Ektodomäne von SARS-CoV. (A) Westernblot des Elutionsprofils des exprimierten S-Proteins von SARS-CoV nach NiNTA-Aufreinigung. M–Marker, B–Bindungsfraktion, W–Waschfraktion, E–Eluatfraktion, 1 - 5: 100–500 mM Imidazol. (B und C) SDS-PAGE: S-Proteinbanden unter reduzierenden (B) und nicht-reduzierenden (C) Bedingungen (siehe Material und Methoden, sowie Text). (C) Native Gelelektrophorese. HMW – High Molecular Weight Marker (Hochmolekulargewichtsmarker). Die Proteine im 10%igen Polyacrylamidgel wurden mittels Silberfärbung sichtbar gemacht.

Zur Untersuchung des Oligomerisierungsgrades des S-Proteins wurde ferner ein nicht-reduzierendes/natives Gel angefertigt (Abbildung 9 C). Im Wesentlichen wurden zwei Oligomerisierungsgrade beobachtet. Die Mehrheit der S-Proteine bildeten Trimere mit einem Molekulargewicht von 500 kDa aus (Abbildung 9 C). Eine Bande mit einem etwas höheren Molekulargewicht von ca. 660 kDa entspricht womöglich höheren Oligomerisierungsformen (Tetramere). Ferner finden sich eine schwache Monomerbande und Proteinbanden mit einem niedrigeren Molekulargewicht, möglicherweise Abbauprodukte des viralen Proteins. Eine Dimerisierung des S-Proteins konnte nicht beobachtet werden.

↓51

Abbildung 10: Expression der Volllängenvariante des S-Proteins von SARS-CoV. Nach Lyse der transfizierten Zellen wurden die Proteine zunächst über eine SDS-PAGE aufgetrennt, anschließend über Westernblot und nachfolgender Detektion mit dem polyklonalen anti-S-Full #IMG542 Antikörper analysiert (Details in Material und Methoden). NC - Negativkontrolle, S - Spike, C-100 – Centricon-100 

Die Expression der Volllängenvariante des S-Proteins von SARS-CoV erfolgte in HEK293T-Zellen und wurde nach Solubilisierung der Zellmembranen mit einem detergenzhaltigen Puffer isoliert. Die Detektion der Proteine erfolgte nach Auftrennung über eine reduzierende SDS-PAGE und den anschließenden Westernblot. Die Proteinausbeute war bei keiner der gezeigten Fraktionen zufrieden stellend und auch nach Konzentrierung der Proteine konnte keine Anreicherung festgestellt werden (Abbildung 10 Spur 4). Der polyklonale Antikörper #IMG-542 zeigte nicht die gewünschte Spezifität (Abbildung 10 Spuren 1, 3 und 5). Zum einen lag dies an der deutlich höheren Zahl an Fremdproteinen im gewonnenen Gesamtzelllysat, welche auch nach der differentiellen Dichtezentrifugation nicht reduziert werden konnte. Eine hochreine Aufreinigung des Proteins wie im Fall der S-Ekto Variante war mit diesem Konstrukt und der angewandten Methode nicht möglich.

D.1.3 Klonierung und Expression der Volllängenvariante des S-Proteins von SARS-CoV mit myc-(His)6-Tag

Nach erfolgreicher Aufreinigung der sezernierten Variante des S-Proteins von SARS-CoV wurde die Volllängenvariante des Proteins (S-Full) mit einem myc-(His)6-Tag kloniert und exprimiert. Für die Klonierung wurde der vorhandene Vektor pcDNA3-S-Full verwendet. Als Zielvektor wurde die pcDNA3.1 myc/His A mit einem C-terminalen myc und (His)6-Epitop verwendet. Der die Sequenz für das S-Protein beinhaltende Donor-Vektor pcDNA3-S-Full wurde einem Restriktionsverdau mit BamHI und XbaI unterzogen, um die entsprechende DNA-Sequenz (Insert) für das S-Full Protein zu erhalten (Abbildung 11 A – Spur 3). Der Akzeptor-Vektor pcDNA3.1 myc/His A wurde ebenfalls verdaut und so linearisiert (Abbildung 11 A – Spur 2). Anschließend wurde die S-Full Sequenz (Insert) über die Restriktionsseiten BamHI und XbaI („sticky ends“ = überhängende Enden) in den Vektor kloniert. Zur Überprüfung der Ligation wurde die Transformation in kompetenten CMK603 Bakterien durchgeführt, diese wurden ausplattiert und sieben positive Klone analysiert. Eine positiver Klon (#7) wurde amplifiziert und nach Verdau mit den verwendeten Restriktionsenzymen BamHI und XbaI über ein Agarosegel analysiert. Die resultierenden Banden (Vektor und Insert) wiesen das erwartete Molekulargewicht von 5.5 kb pcDNA 3.1/myc-His A Vektor und 3.9 kb das S-Full Insert mit einer Gesamtgröße von ~10 kb auf (Abbildung 11 B - Spur 2). Als Vergleich wurde der unverdaute Vektor analysiert (Abbildung 11 B – Spur 1).

↓52

Abbildung 11: Klonierung der Volllängenvariante des S-Proteins von SARS-CoV mit myc-His-Tag. (A) Verdau des pcDNA3.1/myc-His A Vektors mit BamHI und XbaI (Spur 2, Größe ~5.5 kb). Verdau der S-Full beinhaltenden pcDNA3.1 mit BamHI und XbaI (Spur 3, ~3.9 kb) und die anschließende Überprüfung der Ligationsansätze #2-#9. (B) Zur Verifizierung der Ergebnisse wurde nach Amplifikation der pcDNA3.1 myc-His S-Full (Maxipräparation, siehe Material und Methoden) die DNA mit BamHI und XbaI verdaut (Spur 2). Zum Vergleich wurde das unverdaute Plasmid aufgetragen (Spur 1). 

Zur Überprüfung der erfolgreichen Klonierung und Expression der myc-His-getaggten Volllängenvariante des S-Proteins wurden HEK293T-Zellen mit verschiedenen Konzentrationen der pcDNA3.1/myc-His-A-S-Full transfiziert, mit VTF7.3 infiziert und das Proteinexpressionsprofil über Westernblot analysiert (siehe Material und Methoden).

Abbildung 12: Expression der Volllängenvariante des S-Proteins von SARS-CoV mit myc-His-Tag. Inkubation der Westernblots mit dem anti-myc Antikörper (A) und dem anti-S-Full #IMG-542 Antikörper (B) (siehe Material und Methoden). NC – Negativkontrolle; PC – Positivkontrolle.

↓53

Nach Expression der klonierten S-Proteinvariante wurden die Zellen mit einem detergenzhaltigen Solubilisierungspuffer aufgebrochen und einer differentiellen Dichtezentrifugation unterzogen. Als Kontrollen wurden nicht-transfizierte Zellen (NC) und als Positivkontrolle (PC) für den myc-Tag aufgereinigtes S-Ekto Protein mitgeführt. Die Analyse erfolgte sowohl mit dem monoklonalen Antikörper gegen das myc-Epitop (Abbildung 12 A), als auch mit dem polyklonalen Antikörper #IMG-542 gegen ein Epitop auf dem S-Protein von SARS-CoV. Die besten Proteinausbeuten wurden bei einer Konzentration von 12 µg DNA/well erzielt. Die Bande des S-Proteins lief bei einem Molekulargewicht von 200 kDa (Abbildung 12 A und B, jeweils Spur 3). Im Bereich eines Molekulargewichts von 100 kDa ließen sich zwei weitere Banden detektieren, die vermutlich den Untereinheiten S1 und S2 mit einem Molekulargewicht von je 90 kDa entsprachen (Abbildung 12 A). Auch die untransfizierte Kontrolle (NC) zeigte in diesem Bereich ein ähnliches Signal (Abbildung 12 A, Spur 6). Vermutlich reagierte der entsprechende Antikörper in diesem Bereich unspezifisch. Im Bereich der S-Protein Bande wurde bei keiner der Negativkontrollen ein Signal detektiert (Abbildung 12 A und B, jeweils Spur 6). Die Positivkontrolle (PC) dagegen zeigte im erwarteten Molekulargewichtsbereich ein sehr deutliches Signal (Abbildung 12 A, Spur 8).

D.1.4 Expression verschiedener Varianten des ACE2-Rezeptorproteins

VeroE6 Zellen exprimieren den Rezeptor ACE2, der kürzlich als Rezeptor für SARS-CoV identifiziert wurde [156], endogen. Im Experiment wurde das Expressionsniveau von ACE2-Full in VeroE6 Zellen (untransfiziert) und HEK293T Zellen (transfiziert) verglichen. Die verkürzte Variante ACE2-Ekto wurde außerdem in HEK293T Zellen exprimiert. Für die Analyse der Volllängenvarianten mussten die Zellen solubilisiert und die verschiedenen zellulären Membranen wie beschrieben getrennt werden.

Abbildung 13: Nachweis des ACE2-Rezeptors in VeroE6 Zellen und Expression von ACE2 in HEK293T-Zellen. (A) VeroE6 Zellen exprimieren den ACE2-Rezeptor endogen. Mit einem detergenzhaltigen Solubilisierungspuffer inkubierte Zellen wurden nach differentieller Dichtezentrifugation mittels Westernblot und nach Inkubation mit einem gegen ACE2 gerichteten monoklonalen Antiköper analysiert (siehe Material und Methoden). Die entsprechende Proteinbande wurde im Bereich von 110 kDa detektiert. (B) Expression der ACE2-Varianten in HEK293T Zellen. Verdünnungsfaktor 10 bei transfizierten HEK293T-Zellen.

↓54

Abbildung 13 A zeigt das endogene Expressionsniveau von ACE2-Full in verschiedenen Verdünnungen, mit und ohne Zentrifugation. Vergleicht man die endogenen Expressionsraten von VeroE6 Zellen mit denen transfizierter HEK293T Zellen so lässt sich ein deutlicher Unterschied feststellen. Die Ausbeute der verschiedenen Proteinvarianten lag in transfizierten HEK293T Zellen deutlich höher (Verdünnungsfaktor 10) als bei den endogen exprimierenden VeroE6 Zellen (Abbildung 13 B). Die in HEK293T-Zellen exprimierte verkürzte ACE2-Ektodomäne (ACE2-Ekto) wurde ins Zellmedium sezerniert (Vgl. S-Ekto) und konnte in hoher Ausbeute angereichert werden (Abbildung 13 B – Spur 6, beachte Verdünnung 1:10).

D.2 Isolierung und Aufreinigung von MHV-A59

Die Isolierung der Viren sowie des S-Proteins von MHV-A59 erfolgte nach der von Sturman et al. [197] beschriebenen Methode. Intakte MHV-A59 wurden in 17Cl-1 Zellen vermehrt, isoliert, aufgereinigt und konzentriert (siehe Material und Methoden). Das S-Protein wurde anschließend aus der Detergenzextraktion von MHV-A59 aufgereinigt. Das Detergenzextrakt von nativen Coronaviren enthält die membranständigen Glykoproteine S, E und M. Im Vergleich zu den Coronaviren der anderen Untergruppen exprimiert MHV-A59 keine Hämagglutininesterase (HE). Das S-Protein mit einer Größe von 180-250 kDa läuft im Vergleich zu SARS-CoV für MHV-A59 als eine Bande. Es liegt in nicht-reduzierenden nativen Proteingelen als Trimer vor (nicht gezeigt).

Tabelle 18: Physikalische Eigenschaften von Coronaviren

Virusfamilie

Coronaviridae

Virion Mr (x10 6 )

400

Struktur

pleomorph

Größe

120-160

S20W

300-500

Saccharose Schwimmdichte (g/cm 3 (ml))

1.15-1.19

CsCl 2 Schwimmdichte (g/cm 3 (ml))

1.23-1.24

Zusammensetzung

Lipide, Kohlenhydrate, RNA

Empfindlichkeit

Hitze, organische Lösungsmittel, Detergenzien

↓55

Das Molekulargewicht der Coronaviren beträgt durchschnittlich ~ 400 x 106 Da, dies entspricht 400 MDa. Die Viren haben eine pleomorphe Struktur. Die Schwimmdichte der Coronaviren liegt bei 1.23-1.24 g/cm3 in einem CsCl-Gradienten und bei 1.15-1.19 g/cm3  in einem Saccharosedichtegradienten. Der Sedimentationskoeffizient liegt bei 300-500 S. Unter in vitro Bedingungen sind einige Viren stabil und halten sogar Umgebungen mit pH-Werten von bis zu drei stand. In Anwesenheit von Mg2+-Ionen sind die Virionen ebenfalls stabil. Ferner sind Coronaviren hitzeempfindlich, empfindlich gegen lipidlösliche Substanzen, nicht-ionische Detergenzien, Formaldehyd und oxidierende Substanzen. Die allgemeinen physikalischen Eigenschaften der Coronaviren wurden in Tabelle 18 zusammengefasst.

Zur Vermehrung von MHV-A59 in 17Cl-1 Mausfibroblastenzellen wurden die Zellen infiziert, und das virushaltige Medium 46–48 h p.i. geerntet. Nach Zentrifugation der Zellreste (P) wurden die im Überstand befindlichen Viren präzipitiert und zentrifugiert (PEG-Präzipitat, siehe Material und Methoden). Das virushaltige PEG-Pellet wurde zunächst in BisTris-Puffer (pH 6.5) aufgenommen und über einen diskontinuierlichen Saccharosedichtegradienten geschichtet. Nach Ultrazentrifugation war an der Phasengrenze beider Saccharoselösungen eine deutliche Virusbande sichtbar. Diese wurde in BisTris-Puffer aufgenommen und dialysiert, um die Saccharose zu entfernen.

Abbildung 14 : Isolierung und Charakterisierung von MHV-A59. SDS-PAGE (10%), Silberfärbung einer MHV-A59 Virusaufreinigung. Die Virusüberstande P1 und P2 48 h p.i. zeigen zahlreiche Proteinbanden. Das PEG-Präzipitat weist deutlich weniger und schwächere Proteinbanden auf. MHV-A59 Virusaufreinigung über einen diskontinuierlichen Saccharosestufengradienten mit 30 und 50% Saccharose 16 h nach Ultrazentrifugation bei 110,000 x g. Die Virusbande ist nach Zentrifugation an der Phasengrenze zwischen 30 und 50% Saccharose als weißlich, milchig zu erkennen. Das am stärksten exprimierte N-Protein ist in hoher Konzentration vertreten (MHV-Bande bei 45-55 kDa). Ü1 (höchstens 30% Saccharose) und Ü2 (höchstens 50% Saccharose).

↓56

Das Proteinprofil der einzelnen Fraktionen ist in Abbildung 14 dargestellt. Die Überstände P1 und P2 enthalten zahlreiche nicht-virale Proteine, die vor allem aus dem eingesetzten Medium stammen (Abbildung 14, Spuren 1-2). Die viralen Titer dieser Fraktionen liegen bei 1-2 x 107 pfu/ml (Tabelle 19). Nach Präzipitation der Viren nimmt die Zahl der Proteine deutlich ab und der virale Titer um Faktor 10 auf 2.48 x 108 pfu/ml zu (Abbildung 14, Spur 3 und Tabelle 19). Nach Untersuchung der MHV-Virusbande war festzustellen, dass ausschließlich virale Strukturproteine enthalten sind und der virale Titer erneut um das über 2fache auf 6.04 x 108 ansteigt (Abbildung 14, Spur 4 und Tabelle 19 - MHV). Die Überstände Ü1 (Saccharose < 30%) und Ü2 (Saccharose > 50%) entalten ebenfalls hohe Konzentrationen an Viruspartikeln. Die Titer betragen 2.6 x 108 pfu/ml (Ü1) und 4.6 x 108 pfu/ml (Ü2) (Tabelle 19). Nicht-virale Proteinbestandteile, wie BSA, sammeln sich aufgrund ihres Molekulargewichts vorwiegend in Überstand Ü1 an (Abbildung 14, Spur 5).

Tabelle 19: Titerbestimmung der einzelnen Fraktionen nach der Virusaufreinigung

Probe

Volumina (ml)

PFU ∅

Titer (pfu/ml)

P1

26

5

1 x 107

P2

166

9

1.8 x 107

PEG - Präzipitat

7

124

2.48 x 108

Ü1

7

13

2.6 x 108

MHV

2.2

302

6.04 x 108

Ü2

3

23

4.6 x 108

↓57

Zur Isolierung des S-Proteins von MHV-A59 wurden die Virionen zunächst mit detergenzhaltigem Lysepuffer (NP-40-Lysepuffer) solubilisiert. Mit Hilfe eines kontinuierlichen Saccharosedichtegradienten (15-50% Saccharose), der 0.1% NP-40 enthielt, konnten die einzelnen Proteinbestandteile nach Ultrazentrifugation getrennt werden (siehe Material und Methoden). Die anschließende Fraktionierung ergab folgendes Proteinprofil (Abbildung 15):

Abbildung 15 : Isolierung des S-Proteins aus intakten MHV-A59. (A) Isolierung von MHV-A59 (Spur 1), Lyse der isolierten Viren mit NP-40-Lysepuffer (Spur 2 und 3). Fraktionen 20-23 eines kontinuierlichen Saccharosedichtegradienten von MHV-A59 mit den einzelnen Strukturproteinen S, M und N (Spuren 4-7) (siehe Material und Methoden sowie Text). (B) Fraktionen 12-28 eines kontinuierlichen Saccharosedichtegradienten lysierter Virionen. Die einzelnen Strukturproteine von MHV-A59 mit den jeweiligen Molekulargewichten sind rechts aufgeführt. 10%ige SDS-PAGE, Silberfärbung. S - Spikeprotein, M – Matrixprotein, N – Nukleokapsidprotein.

Die Strukturproteine M, N und S von MHV-A59 konnten aus aufgereinigten Viren isoliert werden. In den Fraktionen 20-23 fand sich die reinste Ausbeute an S-Protein (Abbildung 15 B). In fast jeder Fraktion wurden M-Proteinaggregate gefunden (Abbildung 15 A und B). Lediglich in Fraktion 23 (Abbildung 15 A) konnte eine reine S-Protein Fraktion mit der Volllängenvariante S > 250 kDa und einer gespaltenen Variante S1/S2 mit einem Molekulargewicht von 90 kDa isoliert werden. Die Fraktionen mit dem höchsten und reinsten Proteingrad an S-Protein wurden gepoolt, dialysiert und für weitere Experimente verwendet. 

D.3 Elektronenmikroskopische Untersuchungen des S-Proteins von Coronaviren

D.3.1 Elektronenmikroskopische Untersuchungen des S-Proteins von SARS-CoV

↓58

Das S-Protein von SARS-CoV wurden in zwei Varianten exprimiert und aufgereinigt (siehe Ergebnisse, Material und Methoden). Beide S-Proteinvarianten zeigten eine Tendenz zur Aggregatbildung (Abbildung 16 A) und somit gestaltete sich die Identifizierung von Einzelmolekülen schwierig. Damit war auch ein Vergleich mit den publizierten S-Proteinstrukturen von SARS (Beniac et al., 2006) und den Kristallstrukturen der „Coiled-Coil“-Struktur (aus HR1 und HR2-Sequenzen) von SARS-CoV und MHV nicht möglich [159,163,165]. Lediglich einige nicht aggregierte Partikel entsprachen in ihren Abmessungen (ca. 160 Ǻ) der für das S-Protein erwarteten Größe (Abbildung 16 B und Vergrößerung in B-1).

Abbildung 16 : Elektronenmikroskopische Analyse des S-Proteins von SARS-CoV. (A) Elektronenmikroskopische Aufnahme aufgereinigter S-Proteinpartikel (S-Ekto). (B) S-Proteine (S-Full) mit Transmembrandomäne bilden Proteinaggregate. (B-1) S-Protein in Vergrößerung. Balken: 200 nm (A) und 200 Ǻ (B-1).

Zur Vermeidung der Aggregatbildung wurden Ni-lipidhaltige Liposomen (SUVs) hergestellt. Das S-Protein, welches einen C-terminalen (His)6-Tag besitzt, sollte an die in den Liposomen enthaltenen Ni-haltigen Kopfgruppen der Lipide binden und sich ausgehend vom C-Terminus auf der Oberfläche der SUVs orientieren und verschiedene Ausrichtungswinkel einnehmen. Dies hätte gleichzeitig den Vorteil, dass für eine spätere 3D-Rekonstruktion eine Vielfalt von Ansichten mit verschiedenen Raumwinkeln zur Verfügung stehen würde.

↓59

Abbildung 17 : Die Ausrichtung des S-Proteins von SARS-CoV an Ni-lipidhaltigen SUVs. Die exprimierte S-Proteinvariante – S-Ekto besitzt am C-Terminus einen (His)6-Tag, der mit Ni-Ionen chelatiert. Ni-lipidhaltige Liposomen sollten den C-Terminus des S-Proteins binden und somit orientiert werden. (A) Ni-lipidhaltige Liposomen (SUV). (B) Aufgereinigtes S-Protein (S-Ekto) in Lösung. (C) Ni-lipidhaltige SUVs im Gemisch mit der Ektodomäne des S-Proteins. Balken: 100 nm.

Die Ni-lipidhaltigen Liposomen weisen eine Größe ca. 100 nm im Durchmesser auf (Abbildung 17 A). Eine Lösung des S-Proteins (Abbildung 17 B) wurde mit den Ni-haltigen SUVs inkubiert (Abbildung 17 C). Eine Ausrichtung der Proteine an den Liposomen konnte nicht beobachtet werden, allerdings wiesen die Vesikel nach Inkubation mit dem viralen Fusionsprotein sowohl einen größeren Durchmesser als auch eine Veränderung in ihrer Form auf. Die anfänglich runde, gleichmäßige Form wurde zunehmend unregelmäßiger (Abbildung 17 C). Es konnte nicht festgestellt werden, ob die beobachteten Veränderungen der Liposomen auf die Zugabe der S-Proteine zurückzuführen war und welchen Einfluss das Vorhandensein des viralen Fusionsproteins auf deren Gestalt hatte.

D.3.2 Elektronenmikroskopische Analyse des S-Proteins von MHV-A59 

D.3.2.1 Charakterisierung der Konformationsänderung des S-Proteins von MHV-A59

Unbehandelte Viren zeigen pleomorphe oder sphärische Gestalt und weisen einen Durchmesser von 80 – 200 nm (mehrheitlich 120 nm) auf. Die wohl definierten S-Proteine mit einer Länge von ungefähr 20 nm zeigen die Form eines elongierten Dreiecks mit der breiten Seite distal zur viralen Membran (Abbildung 18 A, S1). Die proximale Spitze des Dreiecks ist über eine dünne, flexible Verbindung in der viralen Membran verankert (Abbildung 18 A, S2). Diese Beobachtung ist konsistent mit der bereits von Sturman et al. [197] publizierten.

↓60

Abbildung 18: Elektronenmikroskopische Untersuchung von MHV-A59. (A) Bei neutralem pH (7.4) und RT inkubierte MHV-A59 Partikel. Zur detaillierten Betrachtung wurden zwei S-Proteine (Pfeile) ausgewählt und entsprechend vergrößert. (B-E) Inkubation bei saurem pH (5.0) und 37°C. (F) Inkubation bei neutralem pH (7.4) und 37°C. Balken: 200 Ǻ, 100 nm. (Details siehe Material und Methoden und Text) 

Nach Inkubation der Viren bei niedrigem pH-Wert (5.0) und 37°C werden deutliche strukturelle Veränderungen der S-Proteine sichtbar. Diese entsprechen vermutlich den verschiedenen Stadien der Konformationsänderungen. Einige Viren weisen noch immer S-Proteine auf, jedoch in deutlich geringerer Dichte (Abbildung 18 B-C). Die strukturellen Veränderungen können jedoch nicht eindeutig charakterisiert werden. Zahlreiche Virionen zeigen keine S-Proteine mehr (Abbildung 18 D) oder weisen lange, dünne, elongierte Spikes auf, denen die Kopfregion fehlt (Abbildung 18 E). In Kontrollversuchen mit Virionen, die bei neutralem pH-Wert und 37°C inkubiert wurden, konnten keine Konformationsänderungen im S-Protein beobachtet werden (Abbildung 18 F). Diese Beobachtungen legen nahe, dass eine Konformationsänderung im viralen S-Protein von MHV-A59 direkt durch einen niedrigen pH-Wert induziert werden kann.

D.3.2.2 3D-Rekonstruktion des S-Proteins von MHV-A59

Aus den elektronenmikroskopisch digitalisierten Negativen, die mit einer Primärvergrößerung von 50.000 x unter Low-Dose-Bedingungen mikroskopiert wurden und nach Digitalisierung mittels Heidelberg Primescan Trommelscanner eine Auflösung von 1,56 Ǻ/Pixel besitzen (siehe Material und Methoden), wurden interaktiv zunächst 2.800 brauchbare Einzelpartikel selektiert.

↓61

Abbildung 19 : 3D-Rekonstruktion des S-Proteins von MHV-A59. (A) Auswahl der Klassensummenbilder nach Einzelpartikelmethode (siehe Material und Methoden, Text). (B) Isosurface-Darstellung der 3D-Rekonstruktion des S-Proteins von MHV-A59 in Seitenansicht (Side-View). (C) Isosurface-Darstellung der 3D-Rekonstruktion des S-Proteins von MHV-A59 als „Top“-View. Mögliche Rezeptorbindungsstellen sind pink gekennzeichnet.

Die Bildverarbeitung nach der Einzelpartikelmethode wurde mit der Software IMAGIC-5 durchgeführt und lieferte als Ergebnis von multivariater statistischer Analyse und Klassifizierung typische Projektionen des S-Proteins als Klassensummen (Abbildung 19 A). Diese weisen eine deutlich verbessertes „Signal-zu-Rausch-Ratio“ auf. Die Eigenschaften und Dimensionen des S-Proteins konnten mit dieser Methode sehr gut eingeschätzt werden: Die Grundform erinnert an einen invertierten Kreiskegel mit einer möglichen Gliederung in Stamm- und Kopfregion bei einer Länge von 160 Ǻ und einem maximalen Durchmesser von 120 Ǻ (Abbildung 19 B und C). Die Anfertigung einer vorläufigen 3D-Rekonstruktion untermauert die in den Klassensummen gewonnen Erkenntnisse. Der dünnen Verbindung proximal zur viralen Membran (rot) folgt eine erste dichtere Zone mit einem Durchmesser von 67 Ǻ (dunkelblau) (Abbildung 19 B). Der Stamm setzt sich bis zu einer Höhe von 90 Ǻ fort (dunkelblau + hellblau) (Abbildung 19 B). Es schließt sich die deutlich breitere Kopfregion mit einem Durchmesser bis zu 122 Ǻ an (grün) (Abbildung 19 B). Die Ansicht von oben bestätigt die Trimerform und dreifache Symmetrie des S-Proteins. Drei exponierte „Flügel“ dominieren die Kopfdomäne und sind vermutlich für die Rezeptorbindung verantwortlich (Abbildung 19 C). Die mutmaßlichen Rezeptorbindungsstellen sind farblich gekennzeichnet.

D.4 Identifizierung des Infektionsweges von MHV-A59 

D.4.1 Die Infektivität von MHV-A59 kann durch lysosomotrope Substanzen und Inhibitoren der Endozytose gehemmt werden

Um zu ermitteln, ob MHV-A59 die Zelle über den endozytotischen, Clathrin-abhängigen Weg infiziert und die Infektion das saure Milieu später Endosomen benötigt, wurde dieser Weg in verschiedenen Mauszelllinien mit Substanzen, die einerseits die Endozytose hemmen oder andererseits die Ansäuerung der Endosomen verhindern [11], inhibiert. Zu den eingangs erwähnten Substanzen gehört Chlorpromazin, welches die Bildung Clathrin-haltiger Vesikel hemmt, indem es das Adapterprotein AP-2 bindet und von der Plasmamembran entfernt [47] und somit die Clathrin-abhängige Endozytose verhindert [38,44,45,46]. Zur Neutralisierung der Umgebung mit niedrigem pH-Wert oder zur Unterbindung der endosomalen Ansäuerung wurden folgende lysosomotrope Agenzien verwendet: (I) Ammoniumchlorid, eine schwache Base, die in endosomalen Vesikeln akkumuliert und deren saures Milieu neutralisiert [5,30,39,59]. (II) Monensin, ein Ionophor, welches den Protongradienten über der endosomalen Membran zerstört und als schwache Base fungiert [28,40,48,49]. (III) Bafilomycin A1 sowie Concanamycin A sind spezifische Inhibitoren der V-Typ H+ -ATPase in eukaryotischen Zellen [36,39,40,60]. Die Konzentrationen der eingesetzten Substanzen und Inhibitoren wurden anhand bereits durchgeführter Untersuchungen an Hüllviren gewählt, deren Infektivität nachweislich vom endosomalen/endozytotischen Weg abhängt [29,30,37,38,40,41,43,44,46,153,198]. Mittels DAPI-Färbung konnte nachgewiesen werden, dass die Behandlung mit den beschriebenen Substanzen keinen Einfluss auf die Überlebensfähigkeit der Zellen hatte (nicht gezeigt).

↓62

Um den Einfluss der inhibitorischen Substanzen auf die Infektivität verschiedener muriner Zelllinien durch MHV-A59 zu testen, wurde der Plaqueassay durchgeführt (siehe Material und Methoden). Alle getesteten lysosomotropen Substanzen zeigen einen signifikanten inhibitorischen Effekt auf die Infektivität durch MHV-A59. Bei Konzentrationen von 20 mM Ammoniumchlorid wurde eine Plaquereduktion von über 50% beobachtet. Der inhibitorische Effekt der anderen verwendeten Substanzen war noch eindeutiger. Die Virusreplikation war bei Konzentrationen von 10 nM Concanamycin A (Con, graugestreift), 100 nM Bafilomycin A1 (Baf A1, dunkelgrau) und 10 µM Monensin (schwarz) fast vollständig inhibiert (Abbildung 20 A). Eine vollständige Inhibierung der Infektivität wurde auch nach Inkubation mit 15 μM Chlorpromazin beobachtet (Abbildung 20, hellgrau).

Abbildung 20: Einfluss inhibitorischer Substanzen auf die Infektivität von MHV-A59. Die Infektivität von MHV-A59 wurde über den Plaqueassay analysiert. (A) Inkubation der Zellen mit Chlorpromazin-HCl (Chlorpr, 15 μM, grau), Bafilomycin A1 (Baf A1, 100 nM, dunkelgrau), Monensin (Mon, 10 μM, schwarz), Concanamycin A (Con, 10 nM, graugestreift) und Ammoniumchlorid (NH4Cl, breit graugestreift). (B) Die Zellen wurden mit 20 mM Ammoniumchlorid (NH4Cl) oder 100 nM Bafilomycin A1 (Baf A1) behandelt und anschließend mit MHV-A59 (schwarz) oder MHV-S4 (grau) infiziert. (C) Einfluss der Cholesterolverarmung von 17Cl-1 Zellen auf die Infektivität von MHV-A59. Grau - MβCD, dunkelgrau - Filipin III. Als Kontrolle wurde VSV (schwarz) verwendet. (D) Einfluss der Proteaseinhibitoren E-64 und Leupeptin (Leu) auf die Infektivität von 17Cl-1 Zellen durch MHV-A59 (grau) und MHV-A59 FI (schwarz). Soweit nicht anders vermerkt, entsprechen die Daten dem Mittelwert des Standardfehlers von wenigstens drei unabhängigen Experimenten. (* - n=1; ** - n=2; # - n=4)

Diese Ergebnisse deuten darauf hin, dass die erfolgreiche Infektion der Zellen durch MHV-A59 über den Clathrin-abhängigen, endozytotischen Weg erfolgt und als Hauptroute für den Eintritt des Virus dient. Zusätzlich scheint eine Umgebung mit niedrigem pH-Wert, wie sie in den endosomalen Kompartimenten der Zelle vorzufinden ist, Voraussetzung für die Freisetzung des Nukleokapsids in das Cytoplasma der Zelle zu sein. Vergleichbare Experimente wurden mit LR-7 und DBT-Zellen, die ebenfalls durch MHV-A59 infizierbar sind, durchgeführt. Die Inkubation dieser Zellen mit den lysosomotropen Substanzen Ammoniumchlorid, Bafilomycin A1, Monensin und Chlorpromazin zeigen den gleichen inhibitorischen Effekt wie bei 17Cl-1 Zellen. Die Infektivität war nach Inkubation mit 100 nM Bafilomycin, 10 μM Monensin oder 15 μM Chlorpromazin vollständig unterdrückt (Abbildung 20 A). Nach Inkubation mit 20 mM Ammoniumchlorid konnte die Infektion bis zu 70% (LR-7) oder zu 100% (DBT) reduziert werden (Abbildung 20 A). Diese Ergebnisse sind konsistent mit der bereits beobachteten Verzögerung der MHV-A59 Infektion Ammoniumchlorid-behandelter L2-Zellen [30]. Im Vergleich dazu bewahrte MHV-S4, ein rekombinantes Virus, welches das S-Protein von MHV-JHM exprimiert und den nicht-endozytotischen, clathrin-unabhängigen Weg des viralen Eintritts nutzt [145,153] seine Infektivität nach Behandlung der Zellen (17Cl-1, LR-7 oder DBT) mit 20 mM Ammoniumchlorid oder 100 nM Bafilomycin größtenteils bei (Abbildung 20 B). Für MHV-S4 infizierte LR-7 Zellen hatten Ammoniumchlorid und Bafilomycin A1 einen geringen Effekt auf die Infektivität (Abbildung 20, graue Balken). MHV-S4 infizierte DBT- und 17Cl-1 Zellen zeigten nach Inkubation mit Ammoniumchlorid ebenfalls keine signifikante Reduktion der Infektivität (Abbildung 20 B). Allerdings lag diese bei MHV-S4 infizierten 17Cl-1 Zellen, die mit Bafilomycin A1 behandelt wurden bei knapp 40% (Abbildung 20, links, grauer Balken).

↓63

Zusätzlich wurden Experimente zur Synzytienbildung virusinfizierter 17Cl-1 Zellen durchgeführt. Während für MHV-A59 infizierte 17Cl-1 Zellen 24 h nach Inokulation (p.i.) keine Synzytien beobachtet werden konnte und lediglich ein geringer Teil der Zellen 48 h p.i. Synzytien zeigte, wurde für MHV-S4 infizierte 17Cl-1 Zellen eine deutliche Synzytienbildung schon 24 h p.i. beobachtet (nicht gezeigt). Die Ergebnisse deuten daraufhin, dass MHV-S4 (JHM) im Gegensatz zu MHV-A59 keinen niedrigen pH-Wert benötigt und die Zell-Zell-Fusion bei neutralem pH-Wert ablaufen kann. Die partielle Inhibierung der Infektivität von MHV-S4 in 17Cl-1 Zellen durch Bafilomycin A1, die in LR-7 Zellen nicht beobachtet wurde, steht in Übereinstimmung mit den Beobachtungen von Nash und Buchmeier [28], die zeigen konnten, dass MHV-JHM je nach Zelltyp verschiedene Eintrittswege nutzen kann.

Neuere Studien gaben zusätzlich Hinweise darauf, dass der Eintritt umhüllter Viren in die Zielzelle mit Lipiddomänen assoziiert ist, die Cholesterol enthalten [26,52,53,54]. Nach der Komplexierung von Cholesterol und Verarmung der Plasmamembran von 17Cl-1 Zellen durch Inkubation mit 15 mM Methyl-β-Cyclodextrin (MβCD) (siehe Material und Methoden) konnte die Infektion mit MHV-A59 vollständig blockiert werden (Abbildung 20 C). Eine Inhibierung der Infektion bis zu 70% wurde nach Inkubation der Zellen mit der cholesterol-bindenden Substanz Filipin III (5 µg/ml) beobachtet (Abbildung 20 C). In früheren Studien wurde bereits gezeigt, dass die eingesetzten Konzentrationen den Eintritt und die Infektivität von umhüllten Viren effizient inhibieren können [26,52,53]. Die gewonnenen Daten sind ein weiterer Beweis für die Notwendigkeit von Cholesterol und/oder Cholesterol-reichen Membrandomänen für den Eintritt und die Infektivität von MHV-A59, wie dies bereits in früheren Arbeiten gezeigt werden konnte [52,54]. Als Kontrolle wurden 17Cl-1 Zellen ferner mit VSV infiziert. VSV kann unabhängig von Cholesterol und/oder Cholesterol-reichen Membrandomänen (Rafts) in die Zelle eindringen [199,200]. Eine geringe Reduktion der VSV-Infektivität von 8% wurde für Zellen beobachtet, die mit MβCD behandelt wurden (Abbildung 20 C). Diese Ergebnisse stützen die Aussage, dass der Haupteintrittsweg von MHV-A59 der endozytotische Weg ist, da frühere Untersuchungen zur Clathrin-abhängigen Endozytose zeigen konnten, dass diese Cholesterol-abhängig ist und nach Behandlung der Zellen mit MβCD inhibiert werden kann [61,201].

D.4.2 Proteaseinhibitoren haben keinen Einfluss auf die Infektivität von MHV-A59

Ferner gibt es Hinweise darauf, dass die Spaltung des S-Proteins von Coronaviren essentiell für deren Fusionsaktivität ist. Abhängig vom Virusstamm erfolgt die Spaltung bereits während der Maturierung in der Wirtszelle. Kürzlich konnte gezeigt werden, dass die Fusionsaktivität/Infektivität von Coronaviren, wie SARS-CoV und MHV-2 von der proteolytischen Spaltung des S-Proteins durch endosomale Proteasen abhängt [5,6,202]. Um diese Frage zu adressieren und zu untersuchen, ob eine solche Spaltung auch für die Fusion von MHV-A59 wichtig ist, wurden 17Cl-1 Zellen in der Anwesenheit von Leupeptin und E-64, Proteaseinhibitoren, die Proteasen, wie Cathepsin L in endosomalen Organellen mit niedrigem pH-Wert inhibieren, mit MHV-A59 infiziert. Diese Inhibitoren wurden in anderen Studien bereits in vergleichbaren Konzentrationen eingesetzt [4,5,6]. In den durchgeführten Experimenten wurde für die Inhibitoren - Leupeptin und E-64 - ein geringer Einfluss auf die Infektivität von MHV-A59 beobachtet (Abbildung 20 D, graue Balken). Die virale Replikation war nur zu 20% für Leupeptin (10 µg/ml) und zu 30% für E-64 (10 µM) reduziert. Vermutlich spielen endosomale Proteasen bei der Infektion und Auslösung der Fusionsreaktion von MHV-A59 eine untergeordnete Rolle. Um die Effektivität der eingesetzten Konzentrationen der Proteaseinhibitoren zu verifizieren, wurden 17Cl-1 Zellen in Anwesenheit der Inhibitoren mit MHV-A59 FI infiziert. MHV-A59 FI exprimiert ausschließlich ungespaltenes S-Protein (siehe Material und Methoden). In Abwesenheit der Proteaseinhibitoren war die Infektivität von MHV-A59 FI vergleichbar mit der von MHV-A59 (Abbildung 20 D, Kontrolle). Im Vergleich zu MHV-A59 (graue Balken) konnte die Infektivität von MHV-A59 FI vollständig inhibiert werden, nachdem die Zellen mit den Inhibitoren Leupeptin (10 μg/ml) oder E-64 (10 μM) behandelt wurden (Abbildung 20 D, schwarze Balken).

D.5 Charakterisierung der Fusionsaktivität von MHV-A59 und SARS-CoV

↓64

Der Auslöser der Konformationsumwandlung des S-Proteins von MHV-A59, welcher das Protein von einem fusionskompetenten/metastabilen in einen fusionsaktiven Zustand versetzt, ist noch unbekannt. Zur Charakterisierung der Konformationsänderung des S-Proteins von MHV-A59 wurde die Fusionsaktivität bei unterschiedlichen Temperaturen und pH-Werten untersucht, um die physikochemischen Bedingungen zu identifizieren, die für eine Strukturveränderung im viralen Fusionsprotein verantwortlich sind. Im wesentlichen kamen zwei Methoden zum Einsatz: (1) Die Fluoreszenzspektroskopie und (2) die Epi- und Konfokalfluoreszenzmikroskopie. Beide Methoden nutzen das Phänomen des Fluoreszenzdequenching des Membranmarkers R18 nach Verteilung in der Lipidmembran zur Visualisierung der Fusionsreaktion zwischen viraler und zellulärer Membran.

D.5.1 Fluoreszenzspektroskopische Untersuchung der Fusion von MHV-A59

Um die durch den Plaquereduktionsassay gewonnenen Hinweise darauf, dass die Fusion von Virus und Plasmamembran nur bei niedrigem pH-Wert effizient ablaufen kann, zu untermauern, wurde der Lipid-Mischungs-Assay basierend auf dem Dequenching des R18-Fluorophors angewandt [193]. Viren, die mit R18 in selbstlöschender Konzentration markiert wurden, wurden mit den Zielzellen bei 4°C inkubiert, um die Bindung zu ermöglichen. Anschließend wurden die Virus-Zell-Komplexe in einer Küvette bei neutralem pH (7.0) und 37°C für 30 min inkubiert. Der pH-Wert wurde durch Zugabe von Zitronensäure (250 mM) auf pH 5.0 erniedrigt (siehe Material und Methoden). Es konnte ein starker und schneller Anstieg der Fluoreszenzintensität beobachtet werden. Dieser wurde der Aufhebung der Selbstlöschung durch die Fusion der Virushülle mit der Plasmamembran der Zielzelle und der damit verbundenen Erhöhung der Fluoreszenzintensität zugeschrieben (Abbildung 21 A). Nach 600 sec waren ca. 25-30% der Viren fusioniert. Längere Inkubation zeigte ein kontinuierliches moderateres Fluoreszenzdequenching, welches bis zu einem Wert von 40% anstieg. Das Dequenching des Fluorophors war ferner temperaturabhängig. Bei 20°C konnte noch immer ein signifikantes Dequenching beobachtet werden, dies erreichte allerdings ein geringeres Ausmaß (Abbildung 21 B). Im Vergleich dazu wurde bei neutralem pH-Wert (pH 7.0) ein kontinuierlicher, aber sehr schwacher Anstieg der Fluoreszenzintensität bei 37°C beobachtet (Abbildung 21 A). Dieser mündete in ein sehr viel geringeres Fusionsausmaß von unter 10%. Vermutlich hing dieser langsame Fluoreszenzanstieg mit dem unspezifischen Übergang des Fluorophors von viraler zu zellulärer Membran oder mit intrazellulären Fusionsereignissen zusammen.

Abbildung 21: Die Fusion von MHV-A59 mit 17Cl-1 Zellen kann durch Erniedrigung des pH-Wertes ausgelöst werden. Nach Bindung R18-markierter Viren an 17Cl-1 Zellen wurde das Fluoreszenzdequenching (FDQ) der Virus-Zell-Komplexe in Suspension verfolgt (siehe Material und Methoden). (A) Zeitverlauf des R18 Fluoreszenzdequenching gemessen bei neutralem (pH 7.0) und niedrigem pH-Wert (pH 5.0). Um den pH-Wert auf 5.0 zu erniedrigen, wurde Zitronensäure (250 mM) zugegeben (Pfeil). Am Ende des Experiments wurde Triton X-100 hinzugefügt, um ein vollständiges Dequenching zu erreichen (+Triton, Pfeil). (B) Ausmaß des Fluoreszenzdequenching (FDQ) nach Messung für 30 min unter den beschriebenen Bedingungen. Die Daten repräsentieren den Mittelwert des Standardfehlers von mindestens 3 unabhängigen Experimenten.

↓65

Als Kontrolle wurde der Fluoreszenzanstieg unter den beschriebenen Bedingungen bei 4°C durchgeführt, bei dem keinerlei Fluoreszenzdequenching beobachtet werden konnte (nicht gezeigt). Die letzte Beobachtung war konsistent mit den mikroskopischen Fluoreszenzdaten. Die R18-Markierung von MHV-A59 hatte keinen Einfluss auf die Infektivität des Virus. Dies konnte durch den Plaqueassay verifiziert werden (nicht gezeigt).

D.5.2 Fluoreszenzmikroskopische Untersuchung der Fusion von MHV-A59 

Um die in den virologischen (Plaqueassay) und fluoreszenzspektrometrischen Experimenten gewonnenen Hinweise darauf, dass ein niedriger pH-Wert die Fusion zwischen viraler und zellulärer Membran auslösen kann, zu untermauern, wurden fluoreszenzmikrokopischen Analysen durchgeführt. Zur Visualisierung der Fusion von MHV-A59 wurden die Viren mit R18 markiert und mit 17Cl-1 Zellen auf Eis inkubiert. Anschließend wurden die Virus-Zell-Komplexe bei 37°C entweder bei neutralem pH (pH 7.0) oder niedrigem pH (pH 5.0) inkubiert, um die Bedingungen des endosomalen Kompartiments zu simulieren (siehe Material und Methoden). Zum Zeitpunkt t=0 konnte eine punktförmige Fluoreszenz beobachtet, welche den entsprechenden an die Plasmamembran der Zielzelle gebundenen Viren zugeordnet werden konnte. Gemäß der Größe der Fluoreszenzpunkte liegt eine gewisse Anzahl der Viren co-lokalisiert oder aggregiert vor (Abbildung 22 D). Ein ähnliches Fluoreszenzbild ergab sich 5 min nach Inkubation bei neutralem pH (Abbildung 22 A). Allerdings wurde erst 15 min nach Inkubation bei pH 7.0 und 37°C ein sehr schwaches R18-Signal entsprechender intrazellulärer Kompartimente beobachtet (Abbildung 22 C). Vermutlich spiegelt diese Markierung die Lokalisierung von MHV-A59 in Endosomen und die anschließende Fusion mit der endosomalen Membran wider. Dies konnte durch die Beobachtung gestützt werden, dass keinerlei intrazelluläre Färbung nach 15-minütiger Inkubation bei neutralem pH und Raumtemperatur festgestellt werden konnte (nicht gezeigt). Es ist bekannt, dass die Endozytose bei Raumtemperatur nur sehr eingeschränkt stattfinden kann [203].

Abbildung 22: Niedriger pH-Wert induziert die Fusion von MHV-A59 mit der Plasmamembran von 17Cl-1 Zellen. R18-markierte Viren wurden bei 4°C an die entsprechenden Zielzellen gebunden. Anschließend wurden die Virus-Zell-Komplexe bei 37°C entweder bei neutralem (pH 7.0, A-C) oder niedrigem pH-Wert (pH 5.0, D-F) inkubiert und mittels Fluoreszenzmikroskopie analysiert. Mild saure Bedingungen (pH 5.0, D-F) simulieren das Milieu des endosomalen Kompartiments und ermöglichen dem Virus die direkte Fusion mit der Plasmamembran der Zielzelle (E). Fusion der Viren mit der Plasmamembran konnte bei neutralem pH nicht beobachtet werden (A und B). Nach 15 min wurde lediglich eine schwache intrazelluläre Färbung festgestellt (C).

↓66

Im Vergleich zur Inkubation bei pH 7.0 wurde eine starke Verteilung des Fluorophors R18 über die gesamte Plasmamembran bereits 5 min nach Inkubation bei pH 5.0 und 37°C beobachtet (Abbildung 22 E). Dies impliziert eine schnelle, effiziente Fusion der viralen Hüllmembran mit der Plasmamembran der Zielzelle unter diesen Bedingungen. Längere Inkubation bis zu 15 min (t=15) führte zu keinem signifikanten Anstieg der Fluoreszenz der Plasmamembran (Abbildung 22 F). Um diese Beobachtungen zu untermauern und die pH-abhängige Fluoreszenzmarkierung der Virus-Zell-Komplexe detaillierter zu analysieren, wurden konfokalmikroskopische Studien durchgeführt. Dazu wurden 17Cl-1 Zellen mit den R18-markierten MHV-A59 Virionen für 30 min bei 37°C und neutralem pH-Wert (pH 7.0) inkubiert und fluoreszenzgefärbte zelluläre Organellen beobachtet, die vermutlich Endosomen entsprachen. Diese erschienen angefüllt mit fluoreszenzmarkierten Viren oder die Viren waren bereits mit diesen Organellen fusioniert (Abbildung 23 A und B, Pfeilspitzen). Dies konnte durch die Analyse eines 3D-Stacks konfokaler Bilder (Abbildung 23 A) und der anschließenden Erstellung eines Fluoreszenzplots entlang der x- und y-Achsen, die eine Seitenansicht ermöglichte (Abbildung 23 B), verifiziert werden. Eine Markierung der Plasmamembran wurde unter neutralen pH-Bedingungen nicht beobachtet.

Abbildung 23 : Konfokalmikroskopische Analyse der Fusionseigenschaften von MHV-A59. (A und B) Inkubation der Virus-Zell-Komplexe bei neutralem pH-Wert. Analyse des 3D-Stacks konfokaler Bilder. (C und D) Nach Simulation des endosomalen/lysosomalen Milieus durch Inkubation der Virus-Zell-Komplexe bei pH 5.0. Analyse der 3D-Stacks konfokaler Fluoreszenzbilder (siehe Material und Methoden). Balken: 10 μm. Sterne entsprechen der Position des Zellkerns.

Im Gegensatz dazu zeigen Virus-Zell-Komplexe nach Inkubation bei pH 5.0 und 37°C schon nach 5 min eine starke Fluoreszenz, die über die gesamte Plasmamembran der Zelle verteilt ist (Abbildung 23 C und D). Die Fusion der Viren mit der Zielzelle findet unter niedrigen pH-Bedingungen, die das Milieu der Endosomen/Lysosomen simuliert, effizient und schnell, direkt an der Plasmamembran der Zielzelle statt. Die Analyse der konfokalen 3D-Stacks sowie die Erstellung konfokaler Fluoreszenzplots entlang der x- und y-Achsen konnten bestätigen, dass ausschließlich die Plasmamembran der Zelle gefärbt war (Abbildung 23 D). Um zu klären, ob die beobachtete punktförmige intrazelluläre R18-Fluoreszenz bei neutralem pH mit der Fusion der Viren mit der endosomalen Membran zusammenhing, wurden 17Cl-1 Zellen mit 20 mM Ammoniumchlorid vorinkubiert und die intrazelluläre Färbung nach Inkubation der Virus-Zell-Komplexe bei pH 7.0, 37°C für 30 min in Anwesenheit des Inhibitors analysiert. Als Kontrolle wurden unbehandelte Zellen unter gleichen Bedingungen analysiert (Abbildung 24 B). Diese Zellen zeigen eine ähnliche zelluläre Markierung kleiner, zellulärer Organellen wie bereits beschrieben. Für die Zellen, die mit Ammoniumchlorid behandelt wurden, zeigte sich eine andere intrazelluläre Markierung. Das Fluoreszenzsignal war geringer und eher schwach (Abbildung 24 A). Vermutlich konnten einige Viren internalisiert werden (punktförmige Fluoreszenz), die eigentliche Fusion mit der endosomalen Membran jedoch konnte durch die lysosomotrope Aktivität des Ammoniumchlorids verhindert werden. Zu bemerken war außerdem, dass die punktförmigen Fluoreszenzsignale an der Plasmamembran der Kontrollzellen auch noch 30 min nach Inkubation zu beobachten waren. Diese entspricht vermutlich Viren, die noch nicht über Endozytose in die Zellen aufgenommen wurden. Zusätzlich untermauern diese Beobachtungen die Erkenntniss, dass MHV-A59 unter neutralen pH-Bedingungen nicht fähig ist mit der Plasmamembran zu fusionieren, wie dies für Virus-Zell-Komplexe der Fall ist, die bei niedrigem pH inkubiert werden. Ähnliche Ergebnisse wurden auch für Zellen erzielt, die mit Bafilomycin A1 inkubiert wurden (nicht gezeigt).

↓67

Abbildung 24: Die Inkubation der Zellen mit Ammoniumchlorid verhindert die intrazelluläre Markierung bei neutralem pH. 17Cl-1 Zellen wurden mit Ammoniumchlorid vorinkubiert (A und B – 20 mM NH4Cl) oder bleiben unbehandelt (C und D – Kontrolle) (siehe Material und Methoden). Anschließend werden R18-markierte MHV-A59 an die Zielzellen gebunden und die Virus-Zell-Komplexe bei 37°C für die angegebenen Zeiten inkubiert (siehe Material und Methoden). Ammoniumchlorid ist während der gesamten Infektions- und der Inkubationszeit zugegen.

Das intrazelluläre Markierungsmuster der Zellen, die mit fluoreszenzmarkierten MHV-A59 bei pH 7.0 und 37°C in der Anwesenheit der Proteaseinhibitoren E-64 und Leupeptin inkubiert wurden, ist analog zu dem bei den unbehandelten Kontrollzellen beobachteten (nicht gezeigt). Diese Ergebnisse untermauern, dass eine zusätzliche Spaltung des S-Proteins von MHV-A59 in der Zielzelle nicht notwendig ist, um die Virus-Zell-Fusion zu induzieren, da es im maturierten Virus bereits gespalten vorliegt.

D.5.3 Fluoreszenzmikroskopische Untersuchungen der Fusionseigenschaften von SARS-CoV

Das Fusionsverhalten S-Protein exprimierender Zellen zur Identifizierung des Auslösers der SARS-CoV vermittelten Fusion wurde im weiteren Verlauf der Experimente fluoreszenzmikroskopisch untersucht. Die Zielzellen tragen den humanen ACE2-Rezeptor auf ihrer Oberfläche. Zur Visualisierung der Zell-Zell-Fusion werden die Zellen mit fluoreszierenden Farbstoffen markiert und die Fusion unter verschiedenen Bedingungen (pH-Wert, Temperatur, Proteasen) untersucht. Die Volllängenvarianten der Proteine werden in den entsprechenden Zellsystemen exprimiert (siehe D.1 und Material und Methoden).

↓68

Zunächst wird das Expressionsniveau der Proteine in den entsprechenden Zellsystemen überprüft. Für die Detektion der Proteine auf der Oberfläche der Zellen und zur Überprüfung der korrekten Lokalisierung in der Plasmamembran werden die Zellen mit einem gegen das Protein gerichteten Primärantikörper und anschließend mit dem entsprechenden Sekundärantikörper, der zusätzlich mit einem Fluorophor gekoppelt ist, inkubiert (siehe Material und Methoden). Für das S-Protein und den ACE2-Rezeptor konnte bestätigt werden, dass beide Proteine in der Plasmamembran auf der Oberfläche der Zellen lokalisiert sind (Abbildung 25).

Abbildung 25: Die Lokalisierung des S-Proteins von SARS-CoV und des ACE2-Rezeptors in HEK293T-Zellen. Die Detektion der Volllängenvarianten des S- und ACE2-Proteins erfolgte durch Inkubation mit den entsprechenden Primärantikörpern anti-S-Full #IMG-542 gegen das S-Protein und anti-hACE2 gegen den ACE2-Rezeptor. Die Sekundärantikörper waren jeweils mit verschiedenen Fluorophoren gekoppelt (siehe Material und Methoden). Die Aufnahmen erfolgten mittels Fluoreszenzmikroskopie. 

Für die Fusionsexperimente war es außerdem wichtig die S-Protein exprimierenden HEK293T Zellen (HEK293T-S) zusätzlich mit einem zellulären Farbstoff zu markieren. Dazu wurden diese parallel mit dem pEYFP-N1-Plamid transfiziert, welches die Information für eine Variante des GFP-Proteins – EYFP – enthielt. EYFP liegt nach Expression löslich in der Zelle vor (nicht gezeigt). Die Überprüfung der Co-Expression von pEYFP und S-Protein ergab allerdings, dass keine der pEYFP-positiven Zellen auch S-Protein auf ihrer Oberfläche exprimierten (nicht gezeigt). Demzufolge wurden die Zellen für die folgenden Fusionsexperimente mit anderen cytosolischen Markern markiert (siehe Material und Methoden).

↓69

Die Fusion S- und ACE2-exprimierender Zellen wurde einerseits nach Inkubation unter neutralen pH-Bedingungen beobachtet, benötigte dazu jedoch die zusätzliche Inkubation mit Trypsin (Abbildung 26 B). Andererseits wurde auch nach Inkubation der Zell-Zell-Komplexe bei niedrigem pH-Wert (pH 5.0) Fusion beobachtet, die allerdings ohne Zugabe von Trypsin ausgelöst werden konnte (Abbildung 26 A). Die Ergebnisse lassen vermuten, dass eine erfolgreiche Fusion in Anwesenheit des ACE2-Rezeptors bei neutralem pH-Wert eine Spaltung des S-Proteins voraussetzt. Allerdings kommt es allein durch die Erniedrigung des pH-Wertes ohne Zugabe von Trypsin in Anwesenheit des Rezeptors zu einer Konformationsumwandlung im S-Protein, die ausreichend ist, um Zell-Zell-Fusion auszulösen. Die Expression der jeweiligen Proteine wurde über Westernblot analysiert (siehe Material und Methoden). Sowohl S- als auch ACE2-Protein konnten in den Lysaten der fusionierten Zellen nachgewiesen werden. Die untransfizierte Kontrolle (K) war nach Inkubation mit dem anti-ACE2 Antikörper positiv für den ACE2-Rezeptor, da VeroE6-Zellen diesen endogen exprimieren (Abbildung 26). Da die Expression mit dem cytosolischen Marker pEYFP nicht zu den gewünschten Transfektionsraten führte und eine Co-Expression von S- und pEYFP-Protein nicht nachgewiesen werden konnte, wurden im weiteren Verlauf der Experimente die HEK293T-S Zellen mit dem cytosolischen Marker Calcein-AM markiert (siehe Material und Methoden).

Abbildung 26 : Fusion von HEK293T-S Zellen mit VeroE6-ACE2 Zellen. Die Inkubation der Zell-Zell-Komplexe erfolgt entweder bei pH 5.0 (A und B - obere Zeile) oder bei pH 7.0 (C und D) mit (+) oder ohne (-) Trypsinbehandlung und 37°C. S-Protein exprimierende HEK293T-S Zellen wurden zusätzlich mit dem cytosolischen Protein pEYFP transfiziert (grün). ACE2-Rezeptor exprimierende VeroE6-ACE2 werden mit R18 markiert (rot). Nach Überlagerung der Fluoreszenzbilder sind fusionierte Zellen/Zellbereiche gelb (Co-Lokalisierung). Zur Überprüfung der Proteinexpression wurde ein Westernblot angefertigt (rechte Spalte), (siehe Material und Methoden). K - untransfizierte Kontrolle.

Zur Untersuchung der Fusion von S-Protein und ACE2-Rezeptor exprimierenden Zellen werden VeroE6-ACE2 Zellen mit dem Membranmarker R18 (rot) und HEK293T-S Zellen mit dem cytosolischen Marker Calcein-AM (grün) markiert. Ein deutliches Mischen der (1) Membranlipide (rot) und des (2) Cytosols (grün) kann nach Inkubation bei pH 5.0 und Zugabe von Trypsin (+) beobachtet werden (Abbildung 27 A). Dies deutet auf eine vollständige Zell-Zell-Fusion hin. Diese ist einerseits durch das Mischen der Lipide („Lipid Mixing“, R18 -rot) und andererseits durch das Mischen des cytosolischen Inhalts („Content Mixing“, Calcein-AM (grün)) charakterisiert. Im Gegensatz dazu wird ohne Zugabe von Trypsin (-) unter niedrigen pH-Bedingungen (pH 5.0) sowie unter neutralen pH-Bedingungen mit (+) oder ohne (-) Trypsin lediglich die Mischung der Lipide („Lipid Mixing“) beobachtet (Abbildung 27 B-D).

↓70

Abbildung 27 : Untersuchung der Fusion S-Protein und ACE2-Rezeptor exprimierender Zellen. (A-D) Zur Untersuchung der Zell-Zell-Fusion wird die Membran der VeroE6-ACE2 Zellen mit R18 markiert (rot). Das Cytosol der HEK293T-S Zellen wird mit dem cytosolischen Marker Calcein-AM markiert (grün) (siehe Material und Methoden). Die Inkubation der Zellen erfolgt bei niedrigem (pH 5.0) oder bei neutralem pH-Wert (pH 7.4) mit (+) oder ohne (-) die Zugabe von Trypsin. (F-H) Untersuchung der Zell-Zell-Fusion von Calcein-AM – HEK293T-S Zellen (grün) und CMTMR-VeroE6-ACE2 Zellen (rot) unter niedrigen oder neutralen pH-Bedingungen ohne Inkubation mit Trypsin (-). Als Kontrollen (K) werden nicht-transfizierte HEK293T-Zellen mit VeroE6-Zellen unter niedrigen pH-Bedingungen und 37°C analysiert.

Dies deutet auf Hemifusion hin. Die äußeren Leaflets verschmelzen, eine vollständige Fusion findet jedoch nicht statt. Ähnliches kann außerdem nach Inkubation Calcein-AM gefärbter HEK293T-S Zellen (grün) mit CMTMR-gefärbten VeroE6-ACE2 Zellen (rot) beobachtet werden (Abbildung 27 F-H). Unter diesen Bedingungen (pH 5.0 und pH 7.0, jeweils ohne Trypsin (-)) findet keine vollständige Zell-Zell-Fusion statt (Abbildung 27 F-H). Die jeweiligen Kontrollexperimente mit nicht-transfizierten Zellen werden bei pH 5.0 ohne Trypsinbehandlung (-) durchgeführt. Keine der Kontrollen zeigt Zell-Zell- oder Hemifusion (Abbildung 27 E und H).

Zusammenfassend sprechen die Ergebnisse dafür, dass eine vollständige Zell-Zell-Fusion („Content“- und „Lipid-Mixing“) von HEK293T-S und VeroE6-ACE2 Zellen erst nach Inkubation bei pH 5.0 nach proteolytischer Spaltung (Trypsin) und 37°C ausgelöst werden kann. Zusätzlich kommt es nach Inkubation bei niedrigem pH-Wert auch ohne die Zugabe von Trypsin zur so genannten Hemifusion („Lipid-Mixing“) (Abbildung 27 B-D). Im Gegensatz dazu wird „Content-Mixing“ ohne Trypsin (-), weder unter neutralen noch unter niedrigen pH-Bedingungen beobachtet (Abbildung 27 F und G). Vermutlich wird allein durch die Interaktion mit dem ACE2-Rezeptor eine Konformationsänderung im S-Protein ausgelöst, welche zur Fusion der äußeren Leaflets von viraler und zellulärer Membran führt. Unklar bleibt, welche Rolle ein niedriger pH-Wert bei der Auslösung der Konformationsänderung/Fusionsreaktion spielt. Zum einen könnte die pH-Erniedrigung notwendig sein, um die für die Spaltung des S-Proteins erforderliche endosomale Protease zu aktivieren [6] oder sie ist direkt an der Initiierung der Konformationsumwandlung des S-Proteins beteiligt. Außer Frage steht die Notwendigkeit des ACE2-Rezeptors für die Initiierung der Konformationsumwandlung im S-Protein, da Kontrollzellen ohne ACE2-Rezeptormolekül nicht fähig sind mit S-Protein exprimierenden Zellen zu fusionieren (nicht gezeigt). Zusätzlich sind Zellen, die kein S-Protein exprimierten unter den getesteten Bedingungen (pH 5.0, 37°C) fusionsinkompetent (Abbildung 27 E und H). Die Initiierung der Konformationsänderung im S-Protein von SARS-CoV und die anschließende Auslösung der Fusion ist somit von 3 Faktoren abhängig: (1) Von der Interaktion mit dem ACE2-Rezeptor. (2) Von der anschließenden und/oder gleichzeitigen proteolytischen Spaltung des S-Proteins durch eine Protease (endosomale, zelluläre oder extrazelluläre) und (3) einem niedrigen pH-Wert (pH 5.0), der durch ein zelluläres Organell mit niedrigem pH-Wert bereitgestellt werden muss.

D.6 Irreversibilität der Konformationsumwandlung des S-Proteins von MHV-A59 

↓71

Zur Analyse der Konformationsumwandlung im S-Protein von MHV-A59 werden die Viren bei einem pH-Wert von 5.0 in Abwesenheit der Zielmembran inkubiert. Die Inkubation R18-markierter Viren erfolgt entweder bei 37°C oder 4°C (siehe Material und Methoden). Vor Bindung der Viren an die Zellen wird die Suspension neutralisiert. Anschließend werden die Virus-Zell-Komplexe bei pH 5.0 oder pH 7.0, 37°C inkubiert und epifluoreszenzmikroskopisch oder fluoreszenzspektrometrisch analysiert. Ferner wird die Infektivität vorinkubierter, nicht-markierter Viren im Plaqueassay getestet.

.

Abbildung 28: Die Fusionsaktivität und Infektivität von MHV-A59 kann durch Vorinkubation bei niedrigem pH-Wert beeinträchtigt werden. R18-markierte Viren werden bei niedrigem pH-Wert für 15 min bei 37°C (A) oder 4°C (B) inkubiert. Nach Neutralisierung werden die so behandelten Viren an 17Cl-1 Zellen gebunden. Die Virus-Zell-Komplexe werden anschließend bei pH 5.0 und 37°C inkubiert. (A und B) Links – Phasenkontrast, Rechts – Fluoreszenzbilder. (C) Quantifizierung der Zellen, die eine Fusion zwischen R18-markiertem Virus und der Plasmamembran zeigen. Schwarze Balken – Inkubation bei pH 7.0, graue Balken – Inkubation bei pH 5.0. (D) Plaqueassay und FDQ-Assay vorinkubierter MHV-A59 Viren (siehe Material und Methoden). Die Werte entsprechen dem Mittelwert des Standardfehlers von mindestens drei unabhängigen Experimenten.

↓72

Werden fluoreszenzmarkierte Viren in Abwesenheit von Rezeptor und Zielmembran bei niedrigem pH und 37°C inkubiert, so kommt es zu einem irreversiblen Verlust der Fusionsaktivität (Abbildung 28 A, C und D). Selbst nach Neutralisierung der Inkubationslösung findet keine Reaktivierung der Fusionsaktivität statt. Dagegen zeigen die Virionen nach Inkubation bei 4°C und pH 5.0 eine unveränderte Fusionsaktivität (Abbildung 28 B und C). Diese Experimente lassen vermuten, dass ein niedriger pH-Wert und erhöhte Temperaturen eine irreversible Konformationsänderung im S-Protein von MHV-A59 auslösen können, ohne die Anwesenheit des Rezeptors zu erfordern. Aufgrund dieser Ergebnisse und der Hypothese einer irreversiblen Konformationsumwandlung im S-Protein, welche durch einen niedrigen pH-Wert bei 37°C ausgelöst werden kann, ist vermutlich auch die Infektivität und Fusionsaktivität des Virus beeinträchtigt. Nach Auswertung des Plaqueassays ist die Infektivität vorinkubierter Viren bis zu 60% reduziert (Abbildung 28 D, Plaqueassay). Zusätzlich wird eine Reduktion der Fusionsaktivität für Viren beobachtet, die bei pH 5.0 und 37°C vorinkubiert wurden. Das Fusionsausmaß sinkt von 40% für unbehandelte Viren (Kontrolle) auf weniger als 10% für vorinkubierte MHV-A59 (Abbildung 29 D, FDQ).

D.7 Identifizierung des Fusionspeptids von MHV-A59

D.7.1 Die Sequenz und Primärstruktur des Spikeproteins von MHV-A59

Ausgehend von der primären Aminosäuresequenz des S-Proteins von MHV-A59 werden die bekannten Kriterien für Fusionspeptide herangezogen (Einleitung, Material und Methoden). Der erste Schritt besteht darin die primäre Aminosäuresequenz in die bekannten Proteindomänen zu unterteilen.

Abbildung 29: Primäre Aminosäuresequenz und lineares Schema des S-Proteins von MHV-A59. (A) Sequenz des S-Proteins von MHV-A59 im FASTA-Format. Das S-Protein besitzt eine Länge von 1324 Aminosäuren (AS). Das Signalpeptid befindet sich am N-Terminus der S1-Domäne. S1 (AS 17–717 - fett) und S2 (AS 718 – 1324) Untereinheiten bleiben während der Fusion nicht-kovalent assoziiert. Im Bereich der AS 713 – 717 liegt die mögliche Trypsinspaltungsstelle mit der Sequenz RRAHR (blau). Weiter C-terminal liegt die Transmembrandomäne, die aus 20 Aminosäureresten besteht. Der cytoplasmatische C-terminale Teil umfasst 38 AS und beinhaltet zahlreiche Cysteinreste (grün). (B) Schematische lineare Darstellung des S-Proteins von MHV-A59 (modifiziert nach Xu et al. [159]). Die HR-Regionen: HR1 (AS 947-1082) und HR2 (AS 1214-1261) befinden sich in der S2-Untereinheit des Proteins. SP – Signalpeptid, TM – Transmembrandomäne.

↓73

Für die Analyse struktureller und sequenzspezifischer Kriterien zur Auffindung der möglicher Fusionspeptidkandidaten wird zunächst die Primärsequenz des S-Proteins von MHV-A59 #P11224 aus der SwissProtDatabase (http://www.expasy.org/uniprot/P11224) analysiert (Abbildung 29 A).

Die Sequenzanalyse eines Proteins auf Ebene der Aminosäuresequenz ermöglicht die Auffindung einzelner Motive, die für bestimmte Proteinfunktionen wichtig sind. Das S-Protein der Coronaviren ist das größte bekannte virale Fusionsprotein der Klasse I mit einem Molekulargewicht von 150 – 180 kDa. Es ist an zahlreichen extrazellulären Asparagin (Asn)-Resten glykosyliert und kann weitere Modifikationen wie Myristylierungen und Palmitoylierungen aufweisen.

Tabelle 20: Domänenstruktur des S-Proteins von MHV-A59.

Domäne

Aminosäure

Gesamtlänge (AS)

Beschreibung

Signal

1-16

16

Signalpeptid (SP)

S

17-1324

1308

E2/S Glykoprotein

S1

17-717

701

S1

S2

718-1324

607

S2

Extravirale Domäne

17-1265

1249

Extraviral

HR1

947-1082

137

Heptad Repeat 1

HR2

1214-1261

49

Heptad Repeat 2

Transmembrandomäne

1266-1286

21

TM

Cytoplasmatische (intravirale) Domäne

1287-1324

38

C-terminale (intravirale) Domäne

Cysteinreiche Domäne

1287-1304

18

Cys-Domäne

↓74

Die primäre Aminosäuresequenz des viralen Glykoproteins lässt sich in zwei Hauptdomänen gliedern. Die N-terminale S1-Domäne (AS 17-717) und die C-terminale S2-Domäne (AS 718-1324) (Abbildung 29 A und B, Tabelle 20). Das Signalpeptid besitzt eine Länge von 16 AS und befindet sich am N-Terminus des Proteins (Abbildung 29 A und B, Tabelle 20). Die Grenze zwischen S1- und S2-Untereinheit bildet die putative Trypsinspaltungsstelle mit der hoch konservierten Sequenz RRAHR (AS 713-717). Besondere Merkmale von Fusionsproteinen sind außerdem die HR-Sequenzen (siehe Einleitung). In einem Fusionsprotein kommen zwei dieser Regionen, HR1 und HR2, vor (Tabelle 20). Für die Fusion von Coronaviren ist die Cysteinreiche Domäne des C-terminalen intraviralen Proteinbereiches nicht essentiell, kann den Fusionsprozess allerdings positiv beeinflussen [204,205].

D.7.2 Analyse der Aminosäuresequenz des S-Proteins von MHV-A59

D.7.2.1 Hydrophobizitätsplots des S-Proteins von MHV-A59

Die Aminosäurekomposition bestimmt die Eigenschaften einer Proteinsequenz. Zur Analyse und Identifizierung fusionsaktiver Bereiche eines Proteins wurde zunächst ein Hydrophobizitätsplot des S-Proteins von MHV-A59 erstellt. Dieser dient zur Ermittlung hydrophober Proteinbereiche. Die Erstellung der Hydrophobizitätsplots basiert auf der Hydrophobizitätsskala einzelner Aminosäurereste nach Wimley und White (WWIH-Skala) und sagt aus, welche Energiebarriere (ΔG (kcal/mol)) überwunden werden muss, um einen Aminosäurerest von der wässrigen Phase in die Lipidphase zu überführen [181] (siehe Material und Methoden). Hydrophile Reste besitzen einen negativen ΔG-Wert, wogegen hydrophobe Reste einen positiven ΔG-Wert aufweisen. Die durchschnittlichen Hydrophobizitätswerte von 19 Aminosäuren werden unter Nutzung der WWIH-Skala herangezogen, um die entsprechenden Hydrophobizitätsplots zu generieren. Diese werden mit der Software – MPex - [196] erstellt und ausgewertet (Abbildung 30).

Abbildung 30: Hydrophobizitätsplots des S-Proteins von MHV-A59. (A) Hydrophobizitätsplot des S-Proteins von MHV-A59. Am N-Terminus der Proteinsequenz befindet sich eine hydrophobe Region, das Signalpeptid aus 16 AS. Die Transmembrandomäne befindet sich am C-Terminus. (B) Hydrophobizitätsplot der S2-Domäne von MHV-A59. Die S2-Untereinheit des S-Proteins weist vier mögliche Fusionspeptidkandidaten (FP1 – FP4) auf. TM – rot; Hydrophobizität – schwarz; neutralisierte AS-Reste: D (Asp), E (Glu), H (His); FP – Fusionspeptid.

↓75

Nach Erstellung der Hydrophobizitätsplots der Volllängenvariante und der S2-Untereinheit des S-Proteins von MHV-A59 finden sich einige der bereits beschriebenen Charakteristika wieder. Am N-Terminus befindet sich die hydrophobe Signalpeptidsequenz und am C-Terminus die Transmembrandomäne (Abbildung 30 A). Da vermutet wird, dass das Fusionspeptid im Bereich der S2-Untereinheit zu finden ist, wurde zusätzlich ein Hydrophobizitätsplot dieser Sequenz erstellt (Abbildung 30 B). Der Hydrophobizitätsplot für die S2-Region des Proteins zeigt vier mögliche Fusionspeptidkandidaten. Diese werden nach Lage bezüglich des N-Terminus wie folgt durchnummeriert (FP1-4): FP1 liegt am nächsten zum N-Terminus und FP4 am weitesten davon entfernt (Tabelle 21). Es wird angenommen, dass es sich beim Fusionspeptid von MHV-A59 um ein internes Fusionspeptid handelt, was durch den Hydrophobizitätsplot dieser Sequenz bestätigt werden konnte, da keine hydrophobe Region in der Nähe des N-Terminus von S2 identifiziert werden konnte. Die Transmembrandomäne zeigt im Vergleich zu den Fusionspeptidkandidaten den höchsten ΔG-Wert mit 9.9 kcal/mol (Abbildung 30 B). FP1 und FP3 weisen die höchsten ΔG-Werte von 2.86 kcal/mol und 5.56 kcal/mol auf, wogegen die Werte von FP2 und FP4 mit 0.43 kcal/mol und 1.32 kcal/mol eher niedrig ausfallen (Tabelle 21). Die Eingrenzung der vier Fusionspeptidkandidaten erfolgt anhand der Kriterien für Fusionspeptide (siehe Einleitung). Das in der MPex-Software enthaltene Tool „Totalizer“ ermöglicht außerdem die Berechnung des ΔG-Wertes einzelner Sequenzen.

Tabelle 21: Fusionspeptidkandidaten von MHV-A59.

Fusionspeptid

AS

Sequenz

Länge

Δ G
(kcal/mol)

FP1 (Gesamt)

924 - 966

ISGYTTGATAAAMFPPWSAAAGVPFSLSVQYRINGLGVTMNVL

43

2.86

FP1-1

933-960

AAAMFPPWSAAAGVP FSLSVQYRINGL

27

1.98

FP1-2

937-956

FPPWSAAAGVP FSLSVQYR

19

1.82

FP2

1009 - 1027

LNNLLNQLSNRFGAISASL

19

0.43

FP3-1

1108 -1126

YGLYFIHFSYVPISFTTAN

19

5.56

FP3-2

1109-1130

GLYFIHFSYVPISFTTANVSPG

22

3.96

FP4

1144-1162

GYFVQDDGEWKFTGSSYYY

19

1.32

GP2 (EboV)

524-539

GAAIGLAWIPYFGPAA

16

3.32

gp41 (HIV)

512-527

AVGIGALFLGFLGAAG

16

3.45

Ausgehend von den vier vorhergesagten Proteinsegmenten (FP1-4) werden die Eigenschaften mit den bereits identifizierten Fusionspeptiden anderer umhüllter Viren abgeglichen. Die Sequenzen des GP2-Proteins des Ebolavirus und des gp41 des HIV-1 dienen als Referenz. Sie werden nach den beschriebenen Kriterien abgeglichen (siehe Einleitung) [102,104,106,115,116,119,206,207,208]. Aufgrund der Länge kommen für FP1 und FP3 jeweils 2 Sequenzen in Frage (Tabelle 21). FP1 und FP3 sowie Varianten davon zeigen im Hydrophobizitätsplot und dessen Vergleich mit den bereits identifizierten Fusionspeptiden von HIV-1 und EboV die größten Übereinstimmungen (Tabelle 21 und Abbildung 31). Die erste Region (FP1-1) liegt über 200 Reste C-terminal von der Trypsinspaltungsstelle (AS 713 RAHR 717) entfernt, kurz vor der HR1-Region (AS 947-1082), beinhaltet die Reste 933-960 und weist einen ΔG-Wert von 1.98 kcal/mol auf (Tabelle 21, Abbildung 31 C). Eine kürzere Variante dieser Sequenz, FP1-2, liegt etwas C-terminaler, besteht aus den Aminosäureresten 937-956 und weist einen ΔG-Wert von 1.83 kcal/mol auf (Tabelle 21, Abbildung 31 C). FP3 liegt C-terminal zu FP1, erstreckt sich über die Reste 1108-1126 und weist einen ΔG-Wert von 5.56 kcal/mol auf (Tabelle 21 und Abbildung 31 D). FP3-2 hat eine Länge von 22 AS und besitzt einen ΔG-Wert von 3.96 kcal/mol. Die möglichen Fusionspeptide FP1, FP3 und ihre Varianten gehören zur Kategorie der internen Fusionspeptide, wie sie im GP2 von EboV [102] und dem TM-Protein von ASLV [103] vorkommen. Interne Fusionspeptide liegen weit entfernt von der möglichen proteolytischen Spaltungsstelle des viralen Glykoproteins.

↓76

Abbildung 31: Hydrophobizitätsplots der Sequenzen des gp41 von HIV-1, des GP2 von EboV und der FP1-4 von MHV-A59. Die Hydrophobizitätsplots der Glykoproteine von (A) HIV-1 gp41, (B) EboV GP2, (C) der S2-Untereinheit von MHV-A59 FP1 und FP2 und (D) FP3 und FP4. Die roten Balken markieren sowohl die Lage der Fusionspeptide der bekannten Fusionsproteine gp41 und GP2 als auch der Fusionspeptidkandidaten der S2-Domäne von MHV-A59. GP – Glykoprotein.

Die Sequenzanalyse der Fusionspeptidkandidaten und ihrer Varianten offenbart eine Anzahl konservierter Eigenschaften. Alle vier Sequenzen (FP1-1 und –2, FP3-1 und -2) sind kurz, bestehen aus höchstens 27 Aminosäureresten und enthalten vorwiegend hydrophobe Aminosäurereste wie Alanin (A), Glycin (G) und Phenylalanin (F). Ein weiteres typisches Merkmal für interne Fusionspeptide ist der Prolinrest (P) im oder nahe des Zentrums der Peptidsequenz [116,117,118,119]. Die zentralen Prolinreste (P) von FP1 und FP3 liegen jeweils höchstens 2 AS von der zentralen Aminosäure entfernt (Tabelle 21).

D.7.3 Die Lage der möglichen Fusionspeptide im S-Protein von MHV-A59

Abbildung 32 : Lokalisierung der möglichen Fusionspeptide im S-Protein von MHV-A59. (A) Primäre Aminosäuresequenz der S2-Untereinheit (AS 717-1324). Im Bereich der AS 947-1082 liegt die HR1-Region (hellgrau). Die HR2-Region liegt im Bereich der AS 1214-1261 (dunkelgrau). Die möglichen Fusionspeptide FP1-4 sind farblich unterlegt. Die Transmembrandomäne (TM (AS 1266-1286 rot)) liegt C-terminal. (B) Lineares Schema der S2-Untereinheit (modifiziert nach Xu et al. [159]). Maßstabsgetreue Darstellung der Lage der Fusionspeptide (FP1-FP4). Lage der HR1-, HR2- und TM-Region. HR–Heptad-Repaet, TM –Transmembrandomäne. Balken: 50 AS.

↓77

Die für die Fusion essentiellen Strukturen liegen in der S2-Untereinheit des S-Proteins. Die HR1-Region liegt C-terminal der proteolytischen Spaltungsstelle und befindet sich zentral in der S2-Untereinheit, etwas weiter C-terminal befindet sich die zweite HR-Region - HR2 - N-terminal zur Transmembrandomäne (Abbildung 32 A und C).

Die vier Fusionspeptidkandidaten (FP1-4) wurden in der S2-Sequenz farbig unterlegt (Abbildung 32 A) und sind im linearen Schema als schwarze Balken dargestellt (Abbildung 32 C). Nach den Lokalisierungsstudien innerhalb der Primärsequenz der S2-Untereiheit konnten zwei geeignete Fusionspeptidkandidaten - FP1-1 und FP1-2 - identifiziert werden (Abbildung 33).

Abbildung 33: Die Fusionspeptidkandidaten FP1-1 und FP1-2. (A) Hydrophobizitätsplot des FP1 Fusionspeptids und der daraus resultierenden Varianten: FP1-1 und FP1-2. (B) Lineares Schema der S2-Untereinheit. Lage der Fusionspeptide in der S2-Untereinheit. (C) Sekundärstruktur von FP1 (rot).

↓78

FP1-1 und FP1-2 (Abbildung 33, Tabelle 21) befinden sich N-terminal zur HR1-Region, weisen einen ΔG-Wert von 2 kcal/mol auf und stimmen mit der Mehrheit der bereits beschriebenen Kriterien für interne Fusionspeptide überein. Ein zentrales Prolin in beiden Sequenzen könnte mit der Zielmembran interagieren. FP1-1 und FP1-2 befinden sich mindestens 200 AS weit entfernt von der proteolytischen Spaltungsstelle (RRAHR), was sie als interne Fusionspeptide prädestiniert. Für interne Fusionspeptide von viralen Fusionsproteinen der Klasse I ist bekannt, dass sie präferentiell α-helikale Sekundärstrukturen ausbilden [62]. Nach Analyse der möglichen Sekundärstrukturen konnte ermittelt werden, dass FP1-1 und FP1-2 α- Helices ausbilden und einen Helixgrad von über 80% aufweisen (Abbildung 33 C). Zusammenfassend lässt sich sagen, dass FP1-1 und FP1-2 besonders geeignet erscheinen als mögliche Fusionspeptide zu fungieren. Sie erfüllen die wichtigsten Kriterien interner Fusionspeptide.


© Die inhaltliche Zusammenstellung und Aufmachung dieser Publikation sowie die elektronische Verarbeitung sind urheberrechtlich geschützt. Jede Verwertung, die nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung. Das gilt insbesondere für die Vervielfältigung, die Bearbeitung und Einspeicherung und Verarbeitung in elektronische Systeme.
DiML DTD Version 4.0Zertifizierter Dokumentenserver
der Humboldt-Universität zu Berlin
HTML-Version erstellt am:
05.12.2008