Papadopoulos, Sarantos: Untersuchungen genomischer Veränderungen von Mammakarzinomzellen mittels Random Amplified Polymorphic DNA

25

Kapitel 3. Resultate

Die ersten Versuche wurden mit folgendem Profil durchgeführt: 50 Zyklen, die sich aus der Denaturierung bei 94°C für 45 Sek., der Primeranlagerung bei 35°C für 60 Sek., einem Übergang von 420 Sek. zwischen Anlagerungs- und Extensionstemperatur und Polymerisation bei 72°C für 120 Sek. zusammensetzten. Jeder Primer hatte eine finale Konzentration von 0,5 µM und jedes Desoxyribonucleotid 0,2 mM. Die Reaktionen wurden in 4 mM MgCl2, 50 mM KCl und 10 mM Tris-HCl PH 8,3 durchgeführt mit 80 ng DNA, die durch die Phenol/Chloroform/Proteinase K Methode isoliert wurde.

3.1 Zyklenanzahl

Durch Veränderung der Anzahl der Zyklen der PCR wurde beobachtet, dass unter den oben genannten Konditionen nach 25 Zyklen alle Banden in geringeren Mengen produziert wurden, während mit 30 Zyklen nur die Intensität einiger Banden geringer war. Eine ausreichende Amplifikation war mit 35 Zyklen gegeben. Durch zusätzliche Zyklen wuchs auch die Intensität eines Schmiers. Weiter wurde beobachtet, dass ein ekzessives Benutzen von Zyklen z.B. bis zu 80 Zyklen keine Anwesenheit zusätzlicher Banden im Bereich 0-4 Kb als Folge hatte.

Abb. 3: Photo A zeigt die Variierung der Taq DNA Polymerase Konzentration. Reihen 1-8: 0,5, 1, 1,5, 2, 2,5, 5, 7,5 und 10U. Bei 5, 7,5 und 10U entwickelte sich massiver Schmier.

Photo B demonstriert die Variierung der MgCl2 Konzentration. Reihen 1-7: 1,5, 2, 4, 6, 8, 10 und 12 mM. Die zwei Pfeile in der 1. Reihe machen auf 2 Banden ca. 450 bp und 3 kb aufmerksam, die bei Konzentrationen von 4 mM und höher nicht mehr present waren.

Photo C dokumentiert die Variierung der AnzahlZyklenanzahl. Reihen 1- 9: 25, 30, 35, 40, 45, 50, 60, 70 und 80 Zyklen.

25 Zyklen produzierten alle Fragmente in geringer Menge, während 30 Zyklen eine schwache Amplifizierung von Banden unter 600 bp zeigten. Mit steigender Zyklenanzahl vermehrte sich auch der Schmier.

3.2 DNA Konzentration

Um die optimale DNA Konzentration zu ermitteln, d.h. die geringste Menge die zu reproduzierbaren Ergebnissen führt, wurden Versuche durchgeführt in denen sich die DNA Konzentration sich über ein grosses Spektrum erstreckte: von 0,01 ng bis 5 µg in einem 50µl PCR-Ansatz. Zusätzlich wurde DNA aus unterschiedlichen Isolierungen, die mit der selben Methode (Phenol/Chloroform/Proteinase K) von der selben Person und am selben Tag präpariert wurde, getestet. Die Konzentrationen von 50 ng bis 500 ng ergaben für alle DNA Isolate reproduzierbare Ergebnisse. Die erste DNA Konzentration, die zu sichtbaren 1 bis 2 Kb Fragmente führte, war 0,1 ng. Mit 1 ng DNA wurden mehr Produkte registriert, wie auch Unterschiede im niedermolekularen


26

Bereich (400 bp bis 1 Kb). Grössere DNA Quantitäten (1,3 und 5 µg) schwächten die hochmolekularen Banden (~3 Kb) und favorisierten ein Fragment von ca 450 bp. Wie aus der Abb.2 zu entnehmen ist, nahm das Bandenmuster des B Isolats im hochmolekularen Bereich schneller an Intensität ab, als das entsprechende des A Isolats.


27

Abb. 4: Die Reihen 1-9 zeigen die Variation der DNA Konzentration (Lösung A). Sie entsprechen 0,01 ng, 01 ng, 1 ng, 50 ng, 100 ng, 500 ng, 1 µg, 3 µg und 5 µg. Der Pfeil markiert eine Bande ca. 450 bp die bei 1 µg, 3 µg und 5µg sichtbar wurde. Muster die mit 50 ng, 100 ng und 500 ng produziert wurden, waren identisch. Die Reihen 10-19 zeigen Muster die mit DNA der Lösungen A und B abwechselnd produziert wurden. Die Reihen 10 und 11 entsprechen 1ng, 12 und 13 entsprechen 100 ng, 14 und 15 entsprechen 1 µg, 16 und 17 entsprechen 3µg, 18 und 19 entsprechen 5 µg. Das Photo zeigt, dass bei höheren Konzentrationen (3 µg und 5 µg) die von der Lösung B produzierten Muster schneller an Intensität abnahmen.

3.3 DNA Isolierungsmethode

Grosse Aufmerksamkeit wurde der DNA Extraktionsmethoden und der DNA Qualität gewidmet. Auf Grund von Beobachtungen, dass Heparin die PCR inhibiert, wurde EDTA-Blut als Ausgangsmaterial für die DNA Isolierung benutzt. Die DNA wurde aus peripheren Leukozyten der gleichen Person mittels 5 unterschiedlichen Methoden isoliert: mit der Chloroform/Phenol/Proteinase K, der Aussalzungsmethode, mit dem Chelat-bildendem ChelexR Harz, der DNA Isolierungsmethode für PFGE (Pulsed Field Gel Elektrophoresis) mit dem Qiagen DNA Isolierungskit und den Invitek Kit. Jede Methode wurde 3-fach an darauffolgenden Tagen angewendet, um die Tag-zu-Tag Reproduzierbarkeit zu untersuchen. Alle Isolierungsarten haben zuverlässige Resultate ergeben mit Ausnahme der des Chelat-bildenden Harz Chelex benutzt. Der Versuch diese "rohe" Methode mit der Benutzung von Proteinase K in dem Inkubationsschritt zu verfeinern, hat sich nicht als erfolgreich herausgestellt. Ausserdem wurde versucht, ein RAPD Muster zu bekommen, in dem man 0,5 µl oder 1 µl Vollblut pro 50 µl PCR Volumen ampliziert hat. Die Vorbehandlung des Blutes bestant in 20 Temperatur-Zyklen zwischen 90ºC und 50ºC mit einer Verbleibsdauer von 1 Minute bei jeder Temperatur Burckhardt, 1994 . Diese Amplifizierung produzierte nur die niedermolekularen Banden. Ausserdem waren 50 Zyklen ergiebiger als 35.


28

3.4 Mischung von humaner mit humaner DNA und humaner mit bakterieller DNA.

Eines der grössten Probleme der PCR Methode besteht in der Kontamination des DNA Templates. Die Beimischung von fremder DNA kann zur Produktion von zusätzlichen unspezifischen Banden und zur erniedrigten Ausbeute des gewünschten Fragments führen. Um den Einfluss der Kontamination auf das RAPD Bandenmuster zu untersuchen wurden zwei Experimente durchgeführt.

Abb. 5: Mischung der DNA zweier Personen, A und B(in dieser Reihenfolge in ng angegeben): (1)80 von A, (2)75 und 5, (3)70 und 10, (4)40 und 20, (5)40 und 40, (6)20 und 60, (7)10 und 70, (8)5 und 75, (9)80 von B. Die beiden Pfeile weisen auf die Banden deren Intensität ab- und zunimmt.

Als erstes wurde die DNA zweier Individuen in unterschiedlichen Mengen zusammengemischt, so dass die DNA Konzentration in den PCR Hütchen immer 80 ng betrug. Die Fragmentmuster unterschieden sich in zwei Regionen. Eine ca 2,2 Kb Bande nahm an Intensität ab, während eine ca 1,3 Kb, die nur bei einer Person vorkam, zunahm. Erwähnenswert ist, dass 5-10 ng der zusätzlichen DNA ausreichend sind, um eine neue Bande zu produzieren.


29

Abb. 6: Mischung menschlicher und bakterieller(Neisseria meningitidis) DNA (in dieser Reihenfolge in ng angegeben): (1)80, (2)80 und 0,02, (3)80 und 0,2, (4)80 und 2, (5)80 und 10, (6)80 und 20, (7)80 und 60, (8)80 und 100, (9)80 und 200, (10)200, Marker, (12)20 und 60, (13)40 und 40, (14)60 und 20. In der (5) werden zum ersten mal 3 Banden intensiver, die charakteristisch für die bakterielle DNA sind: eine ca. 3000bp, eine ca. 2400bp und eine ca. 1600bp.

Der zweite Test bestand in der Zugabe von steigender Neisseria meningitidis DNA Menge zu 80 ng humaner DNA. Die Bandenmuster zeigten, dass der Umschlagpunkt, d.h. die erste Produzierung von Banden durch Bakterien, mit 10 ng erreicht wurde, und dass diese Unterschiede sich mit steigender Menge an addierter DNA verstärkt haben.

3.5 Mg+2 -, Primer - und KCl Konzentrationen

Eines der Elemente, die für die Stringenz der PCR Reaktion verantwortlich sind, ist die Mg+2 Konzentration, die so niedrig wie möglich sein sollte, um unspezifische Anlagerung zu vermeiden. Eine Serie mit unterschiedlichen Magnesium Konzentrationen konnte zeigen, dass 4 mM Mg+2 oder höher konstante Bandenmuster produzierte, obwohl die hochmolekularen Fragmente bei 10 mM und 12 mM weniger intensiv waren. Im Gegensatz dazu produzierten 1,5 mM und 2 mM zusätzliche Amplimere ca 450 bp und 3 Kb lang, während andere, die bei 4 mM auftraten, wieder verschwanden.

Als nächstes Reagens wurde die Primer Konzentration verändert. Die Konzentration beider benutzter Primer wurde gleichzeitig von 0,5 µM auf 0,25 µM, 0,75 µM und 1 µM erniedrigt oder entsprechend erhöht. Beobachtet wurde, dass alle Muster sich identisch darstellten, jedoch bei einer Konzentration von 0,25 µM divergierten. Hier gewann die grösste Bande leicht an Intensität während die kleinste verschwand. Danach wurde die Konzentration nur des einen Primers von 0,5 µM auf 0,2 µM, 0,4 µM, 0,6 µM und 0,8 µM variiert, während die des anderen Primers konstant bei 0,5 µM bei behalten wurde. Die meisten Banden hatten sich mit Ausnahme mancher schwächeren in der Intensität und Lage nicht verändert. Zu erwähnen ist eine 1,2 Kb Bande, die nur detektierbar war, wenn die SPAP5 Konzentration höher war als die vom SP3 Primer. Die Konzentration der einzelnen Desoxymononucleotiden betrug 0,2 mM im anfänglichen Protokoll. Durch Veränderung ihrer Konzentration und das Beibehalten der anderen Parameter konnte gezeigt werden , dass bei 0,3 mM das gleiche, bei 0,1 mM ein weniger intensives und bei 0,4 mM ein verändertes Bandenmuster ist als mit 0,2 mM produziert wurde.

Durch Variation der Puffermenge wurde die Standard KCl Konzentration von 50 mM um 10%, 20 % und 60 % erniedrigt und erhöht. Die Veränderungen um 10% und 20 % in beiden Richtungen hatten keinen Einfluss auf das Muster. Niedrigere KCl Konzentration um 60 % produzierten nur zwei schwache Banden und einen Schmier.


30

Abb. 7: Auf dem Photo A wird auf den Reihen 1-4 die Variation der Deoxyribonukleotidkonzentrationen: 0,1 mM, 0,2 mM, 0,3 mM und 0,4 mM demonstriert. Die Reihen 5-8 zeigen eine Variation der Konzentration beider Primer: 0,25 µM, 0,5 µM, 0,75 µM und 1 µM respective.

Auf dem Photo B, die Reihen 1-5 zeigen die Produkte von Reaktionen wo die SP3 Konzentration variiert wurde (0,2 µM, 0,4 µM, 0,5 µM, 0,6 µM, 0,8 µM) während SPAP 5 konstant blieb (0,5 µM). In den Reihen 6-10 war SP3 konstant (0,5 µM) während SPAP5 variierte (0,2 µM, 0,4 µM, 0,5 µM, 0,6 µM und 0,8 µM). Der weiße Pfeil zeigt auf eine 1,2 kb Bande die generiert wurde, als die SPAP5 Konzentration höher war als die von SP3. Die Bande ist anwesend in den Reihen 1, 9 und 10. Die Reihe 11 representiert ein Muster das nach alleiniger Amplifizierung der DNA mit SPAP5 produziert wird. Der schwarze Pfeil zeigt auf ein Fragment das ein ähnliches Molekulargewicht mit der 1,2 kb Bande aufweist.

Photo C: Die Reihen 1-7 demonstrieren Produkte von Reaktionen wo die KCl Konzentration variiert wurde: 20mM, 40 mM, 45 mM, 50 mM, 55 mM, 60 mM und 80 mM.

3.6 PCR Additiva

Bestimme Additiva, die häufig bei der klassischen PCR benutzt werden, um die Amplifizierung zu erleichtern, wurden ebenfalls getestet, um einen eventuellen Einfluss auf die RAPD festzustellen. Es wurde auch besonders darauf geachtet, ob diese Zusatzstoffe die Intensität der niedermolekularen Banden (unter 1Kb) verstärken. DMSO Chester &Marshak, 1993 , welches die Tm (melting Temperatur) der Primer und die Separierungstemperatur der Stränge erniedrigt sowie die Amplifizierung der DNA mit komplexer sekundärer Struktur fördert, wurde in den Konzentrationen 2,5%, 5% und 10% benutzt, ohne dass das übliche Muster verändert wurde.

Formamid Sarkar, Kapelner, &Sommer, 1990 , das Anwendung bei der Amplifizierung von GC(Guanosin-Cytosin)-reichen Sequenzen findet, inhibierte bei Konzentrationen von 1,5 % bis 10 % die PCR. Den gleichen Effekt hatte auch die Zugabe von Glycerol Varadaraj &Skinner, 1994 in das PCR-Reaktionsvolumen mit finalen Konzentrationen 2,5 - 10 %. Auch die gemeinsame Benutzung von Formamid und Glycerol war für die PCR hinderlich.

Zwei weitere Substanzen die getestet wurden, waren N,N,N-trimethylglyzin, Betaine genannt, und das Disaccharid Trehalose Weissensteiner &Lanchbury, 1996 . Betaine vereinfacht die Amplifikation von GC-reichen Regionen Baskaranet.al, 1996 , in dem es die Unterschiede in der Stabilität der AT- und GC-reichen DNA Regionen verringert und so die melting Temperatur auf einen gemeinsamen Wert bringt Rees, 1993 . Das Resultat ist, dass die Formation von sekundären Strukturen reduziert wird


31

Henke, Herdel, Jung, Schnorr, &Loening, 1997 . Es wurde eine Serie von Amplifikationen vorgenommen, wobei Betaine finale Konzentrationen zwischen 0,5 Molar bis 3 Molar erreichte. Betaine hatte das gesamte Muster auf eine Bande ca 500 bp reduziert. (Es ist das Bandenmuster einer Amplifikation zu sehen, wobei die Konzentrationvon von Betaine 2,5 M betrug).

Das Disaccharid Trehalose befähigt die Polymerasen ihre normale Aktivität aufrecht zu erhalten (Thermostabilisierung) oder sogar bei höheren Temperaturen noch zu steigern (Thermoaktivierung) bei denen sie eigentlich schon inaktiv sind Carninciet.al, 1998 . Bei der RAPD hat die Benutzung von Trehalose (finale Konzentration 10 %) das Bandenmuster jedoch mit Ausnahme einer ca. 1,2kb langen Bande, die an Intensität zunahm, nicht verändert.

3.7 Heisser Start (Hot Start)

Viele Authoren benutzen den "heissen Anfang" in ihrem Protokoll, um die unerwünschte Anlagerung und darauffolgende Amplifikation von unspezifischen Produkten zu verhindern Mullis, 1991 .

Der "heisse Start" besteht in der Erwärmung der PCR Mixtur, die alle Reagentien bis auf eines beinhaltet, für 30 Sek. bei 94°C. Danach wird die Temperatur auf 80°C gesenkt und das fehlende Reagenz, in diesem Falle das Enzym, dazugegeben. Nach 50 darauffolgenden PCR Zyklen konnten keine Unterschiede registriert werden.

3.8 PAD

Eine der Ursachen einer misslungenen PCR-Reaktion könnte die inkomplette Denaturierung des Templates oder der PCR Produkte sein. Aus diesem Grunde wird häufig vor der eigentlichen Reaktion ein zusätzliches Denaturierungsintervall vorgeschaltet, das auch als PAD (Pre-Ampflification Denaturation) bekannt ist D'Aquilaet.al, 1991 . Meistens dauert es 1 bis 7 Minuten und wird bei 90°C bis 94°C durchgeführt.

Um die Nutzbarkeit dieses Schrittes zu untersuchen, wurden 2 Versuche angesetzt. Während in beiden die PCR Mixturen für 0, 1, 3, 5 und 7 Minuten vorgeheizt wurden, wurde beim ersten das Enzym vor und beim zweiten das Enzym danach hinzugegeben. Nach der Amplifizierung, die aus 50 Zyklen bestand, konnte auch hier keine Unteschiede festgestellt werden.

3.9 Denaturierungstemperatur und Übergang zur Anlagerungstemperatur

Die Variierung der Denaturierungstemperatur zeigte, dass 98 °C zu keiner Amplifizierung führten und dass von 90°C abwärts die Bandenzahl abnahm, bis nur noch ein Fragment bei 80 °C produziert wurde. Die Muster bei 96 °C, 94 °C und 92 °C waren fast identisch mit Ausnahme eines Amplimers von ca 1,2 Kb, das bei 96 °C intensiver erschien. Dieses bestimmte Fragment trat auf und verschwand, aber bei der Variierung der Denaturierungszeit konnte gezeigt werden, dass eine Verlängerung dieser Reaktionsstufe von 45 Sek. auf 60 Sek. genug war, um seine Präsenz zu sichern. Eine Dauer von 15 Sek. minderte die Intensität mancher PCR Produkte während 90 Sek. keinen weiteren Einfluss hatten. In der Standard-PCR sollte der schnellst mögliche Übergang zwischen Denaturierungstemperatur und Anlagerungstemperatur gewählt werden, um die Renaturierung des Template DNA und das unspezifische Anlagern der Primer zu verhindern. Experimente mit Veränderung der Übergangszeit vom Denaturierungsschritt bis zum Anlagerungsschritt zeigten, dass auch sehr lange Transitionen (bis zu 420 Sek.) das Fragmentmuster nicht verändern.


32

Abb. 8: Photo A zeigt die Variierung der Denaturierungstemperaturen. Die Reihen 1-10 entsprechen 98, 96, 94, 92, 90, 88, 86, 84, 82 und 80 °C. Der Pfeill zeigt die auf eine ca. 1,2 kb Bande, dessen Presenz erst einheitlich war als die Denaturierung bei höheren Temperaturen (96 °C) stattfand oder als sie verlängert wurde. (60 Sek. und 90 Sek. anstatt 45 Sek., wie im Photo B gezeigt wird).

Im Photo B demonstrieren die ersten 5 Reihen die Variation der Denaturierungszeit (15 Sek., 30 Sek., 45 Sek., 60 Sek. und 90 Sek.) bei 94 °C. Die Reihen 6 und 9, 7 und 10, 8 und 11 zeigen die Muster die bei Anlagetemperaturen von 15°C, 35°C und 45°C entsprechend gewonnen wurden. Die Reaktionen der Reihe 6, 7 und 8 wurden mit Rampe und die Reaktionen der Reihen 9, 10, und 11 ohne Rampe durchgeführt. Die Pfeile zeigen die Hauptdifferenzen. In Linie 6 eine Bande ca. 800 bp und in Linie 7 eine Bande ca. 3 kb. In Linie 8 die Pfeile markieren eine ca. 450 bp Bande und eine in der Region um die 1,2 kb.

3.10 Anlagerungstemperatur

Die Stringenz einer PCR Reaktion hängt, wie schon erwähnt, von der Mg+2 Konzentration und der Anlagerungstemperatur ab, die im Falle der RAPD niedrig sein sollte. Um den Einfluss der Anlagerungstemperatur auf die PCR Reaktion zu untersuchen, wurden Programme verwendet, in denen die Anlagerungstemperatur Werte so gewählt wurde, das sie sich durch 2°C Addition oder Subtraktion von einem Ausgangspunkt bei 35 °C unterschied. Die Übergangsdauer zwischen Anlagerungs- und Polymerisationstemperatur wurde immer entsprechend angepasst, so dass der Temperaturgradient 1°C pro 11 Sek. betrug. Die Daten zeigten, dass 47°C die obere Grenze des Bereiches darstellte, in dem noch eine Anlagerung stattfand. Um die Unterschiede zu Demonstrieren, wurden aus der breiten Spanne zwischen 15°C bis 47°C drei representative Temperaturen ausgesucht; 15°C, 35°C und 43°C. Die Muster, die bei 15°C und 35°C gewonnen wurden, waren fast identisch mit zwei kleinen Differenzen: bei 35°C zeigte sich eine intensivere Bande bei ca 3 kb, aber verschwand eine kleinere bei ca 800 bp.

Bei 43°C wurde eine zusätzliche Bande bei 450 bp sichtbar, eine vorher schwache nahm an Intensität zu (~1,2 Kb) und eine Doppelbande verschwand (~1,3 Kb).

Als längere Anlagerungszeiten, bis zu 11 Sek., gefolgt von den schnellst möglichen Überleitungen in den Programmen benutzt wurden, konnte die grösste Anzahl von detektierbaren Banden in der


33

Zeitspanne zwischen 5 und 7 Minuten festgestellt werden. Es konnte jedoch beobachtet werden, dass bei 35°C verschiedene Zeiten unterschiedliche Fragmente favorisierten. Ferner waren längere Zeiten bei 43°C als bei 35°C effektiver in dem sie zu intensiveren Amplimeren führten.

Abb. 9: Die ersten 6 Reihen zeigen Muster die bei einer Anlagerungstemperatur von 35°C produziert wurden und die nächsten 6 bei einer Anlagerungstemperatur von 43°C. Es wurden immer Programme benutzt mit dem schnellsten Übergang zwischen Anlagerungs- und Extensionstemperatur. Die Reihen 1 und 7 zeigen Fragmente, die mit einer Anlagerungszeit von 1 Minute produziert wurden, die 2 und 8 mit 3 Minuten, die 3 und 9 mit 5 Minuten, die 4 und 10 mit 7 Minuten, 5 und 11 mit 9 Minuten, 6 und 12 mit 11 Minuten.

3.11 Rampe

Das nächste PCR Intervall wurde als das bedeutungsvollste für die Reproduzierbarkeit der RAPD Fragmente beschrieben Sobral, 1993 . Spezieller, je länger die Überleitung von der Anlagerungs- zur Polymerisationstemperatur, desto stabiler die Fragmentmuster. Dieser Übergang wird auch als Rampe bezeichnet.

Wie die Abb.10 zeigt, wurde eine Serie von Experimenten durchgeführt, wobei 35 Zyklenprogramme benutzt wurden und die Dauer der Rampe von 0 bis 11 Minuten in 2 Minuten-Schritten verlängert wurde. Eine Dauer von 7 Minuten stellte sich als genügend heraus, da längere Rampen die Fragmentprofile nicht verbesserten. Im anschliessenden Test konnte beobachten werden, dass eine Anlagerungstemperatur von 15°C mit dem schnellsten Übergang nur 2 bis 3 intensive Banden produzierte. Die entsprechenden Versuche bei 35°C und 43°C produzierten mehr Fragmente, jedoch ein insgesamt schwächeres Bild. Danach wurden 3 Parameter systematisch verändert: Mg+2 Konzentration, Zyklenanzahl und Dauer der Rampe. Die Produkte der Kombinationen von 2mM und 4mM MgCl, 35 und 50 Zyklen, schnellster Übergang und 7 Minuten Rampe werden im Photo aufgezeigt. Weitere Versuche wurden durchgeführt, bei denen unterschiedlich verlängerte Anlagerungszeiten (0, 180 und 300 Sek.) mit den entsprechenden Rampen benutzt wurden, ohne dass ein besonderer Effekt nachgewiesen werden konnte.


34

Abb. 10: Photo A zeigt die Variation der Rampendauer. Die Reihen 1-7 entsprechen 0, 1, 3, 5, 7, 9 und 11 Minuten Rampen. Eine Rampenzeit von 7 Minuten war ausreichend.

Photo B demonstriert die Kombination von 3 Variablen: Anzahl der Zyklen, Mg2+ Konzentration und Rampe. In den ersten 4 Reihen werden die Produkte gezeigt die bei 2 mM und 4 mM Mg+2 produziert wurden. Die Reihen 1, 2, 5, und 6 zeigen Muster mit Rampe, während 3, 4, 7 und 8 Muster ohne Rampe. Die Zyklenanzahl bei 1, 3, 5 und 7 war 35, während sie bei 2, 4, 6 und 8, 50 Zyklen betrug.


35

3.12 Extensionszeiten

Das erste Experiment bestand in der Variierung der Extensionstemperaturen. Die Temperaturen wurden in 2°C Schritten von 66°C bis 80°C mit den entsprechenden Rampen überprüft, ohne dass grosse Unterschiede zwischen den Mustern sichtbar wurden. Weiter wurden Versuche bei einer Polymerisationstemperatur von 72°C mit Programmen durchgeführt, die entsprechende Rampen (11 sec/°C) und steigende Polymerisationszeiten, nämlich 0 - 5 Minuten, beinhalteten. Diese Serie wurde zusätzlich erweitert, in dem nicht nur Experimente mit einer Denaturierungstemperatur von 35°C, sondern auch mit 43°C durchgeführt wurden. Interessanterweise wurden zwischen den Mustern, die mit und ohne Polymerisationszeiten produziert worden sind, keine Unterschiede beobachtet. Eine Extensionszeit über 4 Minuten führte zur Vermehrung des Schmiers und zur Intensitätsabnahme der Banden.

Abb. 11: Photo A zeigt die Variation der Extensionszeit. Die Muster der Reihen 1-6 wurden bei 35°C produziert, während die der Reihen 7-12 bei 43°C. Die Reihen 1-6 und 7-12 entsprechen 0, 1, 2, 3, 4, und 5 Minuten Extensionszeit. Interessanterweise vermehrte sich der Schmier je länger die Extensionszeit wurde. Die Produktmenge der Reihen 5, 6, 11 und 12 nahm auch zu.

3.13 Programmveränderungen

Während der Optimierung des thermischen Profils wurde versucht, manche Verbesserungen, die häufig in der klassischen PCR angewendet werden, auf die RAPD zu übertragen. Als erstes wurde die Denaturierungstemperatur nach den ersten 10 Zyklen von 94°C auf 88°C reduziert, mit dem Ziel die Produktion der niedermolekularen Fragmente zu fördern Yap &McGee, 1991 .

Der "Plateau"-Effekt Sardelli, 1993 spielt eine Rolle in den letzten Zyklen der PCR und bestimmt somit die Produktmenge. Eine Möglichkeit dieses Phänomen zu überwinden, ist die Extensionszeit in den letzten Zyklen, wenn die Produktkonzentration die Enzymkonzentration überschreitet, zu verlängern. Deshalb wurden die Tests mit


36

Polymerisationszeiten durchgeführt, die sich durch Addition von 10 Sekunden bei jedem zweiten Zyklus für die letzten 20 Zyklen zusammensetzten.

Der "Plateau"-Effekt kann auch durch die Abnahme der Denaturierungsleistungsfähigkeit verursacht werden und deshalb wurde bei Versuchen die Denaturierungstemperatur auf 96°C erhöht.

Um die Auflösung der RAPD Marker zu verbessern, wurden weitere PCR Versuche mit einer zweiten anschliessenden PCR durchgeführt, die unter stringenden Bedingungen ablaufen würde. Nach 50 Zyklen mit einer Anlagerungstemperatur von 35°C wurden 2 µl vom primären PCR Produkt zu 48 µl PCR Volumen mit 1,5 U Enzym addiert und bei einer Anlagerungstemperatur von 43°C für 20 Zyklen inkubiert.

3.14 Enzyme

Im folgenden wurden 37 unterschiedliche DNA Polymerasen (siehe Metarialien und Methoden) von 16 Anbietern getestet. DNA Polymerasen, die vom Thermus thermophilus herstammen, produzierten ähnliche aber nicht identische Bandenmuster, wogegen die Polymerasen aus Pyrococcus furiosus und Thermococcus litoralis sehr wenige Fragmente amplifizierten. Alle Enzyme ergaben reproduzierbare Ergebnisse.

Abb. 12: Bild 1: Enzyme: Amplifikationen in folgende Reihenfolge mit 2,5U Enzym: Invitaq, Invitaq mit Trehalose (finale Konzentration von 10%), Combipol, Combipol mit Trehalose (finale Konzentration von 10%), Appligene Oncor, Super Taq Plus, Takara Taq, Takara Ex Taq, Takara LA Taq, Qiagen Taq, Qiagen Taq mit Q-Lösung ohne Mg+2 , Qiagen Taq mit der Q-Lösung und Mg+2 , Gibco Taq mit Betaine (finale Konzentration von 3M).


37

Bild 2: Amplifikationen in folgende Reihenfolge mit 2,5U Enzym: Goldstar, Dap, Pwo, Vent, Vent mit DMSO(finale Konzentration von 5%), Vent exo-, Deep Vent, Deep Vent exo-.

Bild 3: Amplifikationen in folgende Reihenfolge mit 2,5U: Gibco Taq, Stratagene Taq, Stratagene Taq Plus, Stratagene Taq mit Extender, Stratagene Pfu, USB Taq, USB Tth und USB Hot Tub.


38

Bild 4:Amplifikationen in folgende Reihenfolge mit 2,5U Enzym: Gibco Taq, Promega Taq, Perkin Elmer Amplitaq, Stoffel Fragment, MBI Fermentas Taq, MBI Frementas Tth, Pharmacia Taq, Boehringer Mannheim Taq, Boehringer Mannheim Tth und Boehringer Mannheim Expand High Fidelity.

Von der grossen Anzahl der Thermus aquaticus (Taq) DNA Polymerasen zeigten 4 fast identische Bandenmuster: diejenigen von Life Technologies/Gibco, Stratagene, Pharmacia und Boehringer Mannheim. Folgende Enzyme bevorzugten die Produktion von grossen Fragmenten, manchmal auf Kosten der niedermolekularen: Combipol von Invitek, Takara LA Taq und in kleinerem Maße Takara Ex Taq, Stratagene Taq Plus mit dazu addierten Extender, Expand high fidelity von Boehringer Mannheim und Dap von Eurogentec. Das Hot Tub von USB/Amersham war dabei nicht so erfolgreich.

Es ist beschrieben worden, dass die Amplifizierung mit dem Stoffel Fragment die Produktion der kleinen Banden fördert Sobral, 1993 . In einer Serie von Experimenten konnte diese Beobachtung bestätigt werden. Zusätzlich wurde aber registriert, dass die Banden mit einem molekularen Gewicht von 2 kb und grösser an Intensität abnahmen. Weitere Versuche mit längeren Rampen (bis zu 32 sec/°C) führten zu keiner wesentlichen Verbesserung des Bandenmusters. Eine zusätzliche Verlängerung der Extensionszeit auf 5 Minuten hatte ebenfalls keinen Beitrag in dieser Richtung leisten können. Eine Denaturierungstemperatur von 98 °C führte zur Amplifizierung von nur 2 niedermolekularen Banden. Unterschiedliche MgCl2 Konzentrationen führten auch zu Musterveränderungen; z.B. wurden bei 2 mM MgCl2 niedermolekulare Banden bevorzugt produziert, die bei 4 mM nicht sichtbar waren. Hohe Konzentrationen wie 8 und 10 mM MgCl2 haben sich nicht als vorteilhaft herausgestellt - ganz im Gegenteil - es kam zur Verkleinerung des Spektrums der produzierten Banden.


39

Abb. 13: Amplifikation mit dem Stoffel Fragment: (1) 2,5U bei 2mM Mg+2 und 11Sek./°C (2) 2,5U bei 4mM Mg+2 und 11Sek./°C, (3) bis (5): 2,5U bei 4mM Mg+2 und entsprechenden Rampen von 16 Sek./°C, 24 Sek./°C, 32 Sek./°C, (6) wie (1) aber mit Denaturierung bei 98°C, (7) wie (1) aber mit eine Extensionszeit von 5 Min., (8) 2,5U Gibco Taq bei 4mM Mg+2 und eine Rampe von 11 Sek./°C..

Als nächster Schritt wurde das Stoffel Fragment kombiniert eingesetzt. Zunächst mit der Taq DNA Polymerase von Gibco/Life Technologies, danach mit Goldstar Polymerase von Eurogentec und zuletzt mit der Pfu DNA Polymerase von Stratagene.

Da die Gibco Polymerase ein Optimum bei 50 mM KCl hat, während das des Stoffel Fragments bei 10 mM liegt, wurde eine finale KCl Konzentration von 30 mM KCl gewählt. Kombinationen mit Enzymkonzentrationen von 1 U, 1,25 U und 2 U bei 4 mM MgCl2 haben ähnliche Muster produziert wie bei alleiniger Anwendung der GIBCO Polymerase. Es folgten Kombinationen der Goldstar Polymerase mit dem Stoffel Fragment mit Konzentrationen von 20 mM (NH4) 2 SO4 und 10 mM KCl d.h. den entsprechenden Optima für diese Enzyme, die zur Intensitätszunahme von mehreren niedermolekularen Banden ca 400 - 500 bp führten, ohne dass die Produktion der grossen beeinträchtigt worden ist. Die Kombination des Stoffel Fragments mit der Pfu DNA Polymerase von Stratagene, die auch ein KCl Optimum von 10 mM hat, führte zur Produktion von nur 2 niedermolekularen Banden ca 200 - 300 bp. Bei der Anwendung der Klentaq von Mobitec (Handelsname Mobi-Tab K) wurde festgestellt, dass das produzierte Muster Unterschiede zu dem von der Deltapol (Klentaq der Firma Invitek) aufwies. Das Muster der Deltapol war durch eine Betonung der Banden unter 1 kb charakterisiert, während das der Mobi-Taq K einer Taq DNA Polymerase ähnelte (z.B. Gibco oder Invitaq).


40

Abb. 14: Von (1) bis (12): Amplifikation mit (1) 12,5 U Klentaq bei 8mM Mg+2 , (2) 2,5 U Invitaq bei 4mM Mg+2 , (3),(4),(5),(6) Klentaq und Invitaq mit entsprechenden Einheitenanalogien 10:1, 5:1, 2,5:1, 2,5:1 und jeweils 10U, 10U, 10U und 6,25U Klentaq bei 8mM Mg+2 , (7),(8),(9),(10),(11),(12) Klentaq und Combipol mit entsprechenden Einheitenanalogien 20:1, 5:1, 2,5:1, 2,5:1, 2,5:1, 2,5:1 und jeweils 10U, 10U, 10U, 8U, 8U und 6,25U Klentaq bei 8mM Mg+2 . In der (11) wurde zusätzlich Trehalose (finale Konzentration 10%) benutzt.

Als nächster Schritt wurden Kombinationen von Deltapol, Invitaq und Combipol (Invitek) getestet. Die Enzyme konnten gemeinsam im Optiperform Puffer (10x Puffer, 500 mM K OH, PH 9,2 bei 25 °C und 0,5 % Tween 20) amplifiziert werden. Die MgCl2 Konzentration war für diese Kombinationsexperimente einheitlich 8 mM. Bei der Kombination Klentaq und Invitaq wurden die Relationen 10:1, 5:1 und 2,5:1 Units untersucht, mit dem Einsatz von 10 U und bei 2,5:1 zusätzlichen 6,25 U Klentaq pro 50 µl PCR Volumen. Bei der Kombination Deltapol und Combipol wurden die Relationen 20:1, 5:1 mit jeweils 10 U Klentag pro 50 µl getestet, während bei der 2,5:1 Analogie 10 U, 8 U und 6,25 U Klentaq eingesetzt worden sind. Zusätzlich wurde die Auswirkung von Trehalose auf das Muster bei 8 U Klentaq untersucht. Als letzter Versuch wurde eine Analogie 1:1 Units mit 8 Units Klentaq untersucht. Von den aufgeführten Kombinationen hat die 2,5:1 Klentaq: Combipol mit 8 U Klentaq die besten Ergebnisse erzielt. Das Bandenspektrum war das breiteste in dem mehrere Fragmente unter 1 kb dazu gewonnen wurden, ohne grosse Einbussen bei den Banden um 3 kb zu verzeichnen. Beobachtet wurde zusätzlich eine Intensitätszunahme bei den Banden zwischen 1 und 2 kb. Die Ergebnisse glichen sich, ob nun der Dilutionspuffer von Invitek (beinhaltet zu 50 % Glycerol) für das Mischen der Enzyme benutzt wurde oder nicht.

Mit der Vent DNA Polymerase wurde eine Serie von Experimenten durchgeführt, in der steigende Enzymkonzentrationen angewandt wurden. Obwohl die Ausbeute insgesamt niedrig war, zeigten die 0,5 U die besten Resultate: 8 Banden anstatt einer bei der Reaktion mit 2,5 U. Eine parallele Serie mit 5% DMSO Konzentration in Anlehnung an das für Vent DNA optimierte Protokoll Cease, Potcova, Lohff, &Zeigler, 1994 endete ohne signifikante Verbesserung des Fragmentmusters.

Um das RAPD Protokoll für die Pfu DNA Polymerase zu optimieren, wurden die Anweisungen des Anbieters verfolgt und kleine Anpassungen vorgenommen. Um die Produktion von Amplimeren zu fördern, wurde die Anlagerungstemperatur um 5°C und 10°C erniedrigt, ohne dass ein Vorteil erzielt wurde.

Die Effizienz der Amplifikation wird häufig durch Additiva beeinflusst, wie DMSO und Glycerol. Glycerol (finale Konzentration 2,5% und 5%) und die gemeinsame Benutzung von DMSO (finale Konzentration 5% Glycerol und 10% DMSO) verhinderte die Bandenproduktion. DMSO als alleiniger Zusatz (finale Konzentration 10%) liess das Muster ebenfalls unverändert. Abschliessend ist noch zu erwähnen, dass eine Magnesium-Konzentration von 2 mM für die Produktion von einigen zusätzlichen Banden verantwortlich war.

Die Firma Qiagen bietet zusammen mit der Taq DNA Polymerase auch eine Q-Solution an. Es


41

wurden Versuche mit dieser Lösung abwechselnd mit und ohne MgCl2 Benutzung durchgeführt. Die Anwendung der Q-Solution ohne MgCl2 führte zu einer Reduktion des Musters auf zwei bis drei Banden und die Produktion einer prominenten Bande ca 400 bp. Das mit der Q-Lösung und MgCl2 produzierte Muster konnte die Qualität desjenigen ohne Q-Solution nicht erreichen. Weitere Tests der Q-Solution in Verbindung mit anderen Enzymen wurden auch durchgeführt. Das Stoffel Fragment zusammen mit der Q-Lösung ergab keine Banden, während mit MgCl2 eine Bande produziert wurde.

3.15 PCR Maschinen

Es wurden die DNA-Mobilitätsmuster unterschiedlicher PCR Maschinen von 6 Anbietern untersucht: Perkin Elmer (9600, 2400, 2700), Landgraf (Varius V), Biometra (Trio-Thermoblock), MJR (100 PTC, 150 PTC), Pharmacia (ATAQ Controller) und Appligene (Crocodile). Das erste PCR-Protokoll enthielt den schnellst möglichen Übergang von der Anlagerungstemperatur der Primer zur Polymerisationstemperatur während im zweiten eine Rampe benutzt wurde. Die Thermocycler haben unter Anwendung des ersten Protokolls Fragmentmuster generiert die sich in der Anzahl und Intensität der Amplimere unterschieden. Es wurde festgestellt, dass unter diesen Bedingungen die kürzeren Banden bevorzugt wurden, während die Produktion der längeren abnahm. Das zweite Protokoll, in dem eine Rampe von 11sec/°C benutzt wurde, mit Ausnahme des Appligene Crocodile Gerätes das eine geringste Anstiegsrate von 9sec/°C bietet, produzierte homogene Bandenmuster. Allerdings absolut identisch waren nur die von der Maschine Perkin Elmer, Landgraf und MJR. Spektakulär war der Einfluss der Rampe auf das Muster der Appligene Maschine. Es ist noch zu erwähnen, dass die Maschine der Firma Biometra auch mit Rampe keine absolut reproduzierbaren Ergebnisse produzierte. Für jedes PCR Gerät wurden die ReaktionsHütchen benutzt die der Anbieter/Hersteller vorschreibt. Zusätzlich wurden im Perkin Elmer Thermocycler 0,5ml Eppendorf Hütchen benutzt, in denen die 50µl Reaktionsvolumen mit einem Tropfen Mineralöl überschichtet wurden. In diesem Fall wurde auf die Deckelheizung verzichtet, die bei Benutzung der 0,2ml PE Hütchen angewandt wurden. Das Muster das bei Nichtanwendung der Rampe mit den PE Hütchen produziert wurde, wies grosse Unterschiede zu dem entsprechenden mit Eppendorf Hütchen genierten Muster auf. Die Eppendorf Hütchen haben die Produktion der hochmolekularen Banden erleichtert und auch noch eines niedermolekularen Fragments. Bei Anwendung der Rampe gab es zwischen den Amplimeren nur einen Unterschied: Die PE Hütchen haben ein ca 1,2 Kb Fragment zusätzlich produziert. Es ist noch zu erwähnen, dass die unterschiedlichen Typen des selben Herstellers immer gleiche Resultate produzierten.

Abb. 15: Die RAPD Profile der ersten 6 Reihen wurden ohne Rampe, während die folgenden 6 Reihen mit Rampe produziert wurden. Die Muster 1 und 8 wurden mit der Appligene, die 2 und 9 mit der Pharmacia, die 3 und 10 mit der Biometra, die 4 und 11 mit der MJR, die 5 und 12 mit der Landgraf und die 6,7,13 und 17mit der Perkin Elmer PCR-Maschine produziert. Die 6 und 13 wurden mit den 200 µl Perkin Elmer Hütchen produziert, während die 7 und 14 mit den 500 µl Eppendorf Hütchen.


42

3.16 Visualierungsmöglichkeiten der DNA

Wie schon erwähnt war das Ziel der Optimierung die Visualisierung von Banden mit einer Länge kleiner als 1 Kb. Um dieses Ziel zu erreichen wurden 2-Chloroacetaldehyd (CAA) benutzt, das wie publiziert Premaratne, Helms, &Mower, 1993 nach Reaktion mit der doppelsträngigen DNA die Ethidiumbromidfluoreszenz verstärken soll. CAA ist eine mutagene Chemikalie die mit Adenin, Cytosin und Guanin reagiert. Die mit steigenden CAA Konzentartionen versetzten PCR Produkte zeigten nach Visualisierung auf einen UV-Transilluminator keine sichtbaren Unterschiede zur negativen Kontrolle, diejenige ohne CAA Behandlung.

3.17 Dynamin

Die Amplifikation der DNA Paare, d.h. der DNA aus Mammatumorzellen und aus gesunden Zellen (Leukozyten), von sechs Patientinnen mit dem Primerpaar STARK und TELO3 hat bei allen sechs Fällen zu identischen Ergebnissen geführt. Wie man von der Abbildung 16 entnehmen kann, wurden drei Unterschiede festgestellt: Banden mit einem Molekulargewicht von ca. 500, 700 und 1000bp. Bei allen drei Banden wurde der Versuch gemacht sie weiter zu charakterisieren mittels Klonierung und Sequenzierung. Da es bei den Banden um eine Komigration von DNA Fragmenten handelt Comes, 1997 , wurden hier mehrere Fragmente analysiert. Die Sequenzen wurden mit dem BLAST Programm auf Homologien zu bekannten Sequenzen untersucht. Bei einer ca. 700bp lange Sequenz bestand erhebliche Homologie zur Homo sapiens Dynamin I Sequenz. Der Vergleich zwischen der Sequenz eines Fragments und der Teilsequenz des Klons hRPK.401_G_18, der sich auf dem Chromosom 9 lokalisieren lässt, ergab auf DNA Ebene eine Homologie von ca. 83%. Das Fragment beinhaltet eine kodierende Sequenz die sich von Base Nr. 424 bis zum Ende erstreckt, auf DNA Ebene eine Homologie von 92% zur Dynamin I aufweist und die, wenn sie in eine Aminosäuresequenz übersetzt wird, eine Homologie von 88% zum entsprechenden Dynamin Segment erreicht.


43

Vergleich der Fragmentsequenz mit genomischer DNA

Fragm: 1   tgctggtggtggcacgtacctatagtcctagctactcgacaggctgacattggaggatca 60
              ||||||| |||||| ||| |||||||||||||| || |||||||||||||| ||| |
Clone: 1   ggttggtggtagcacgtgcctgtagtcctagctactggagaggctgacattggaagataa 60


Fragm: 61  ctttgagcccaagaagttgaggctacagtgagtggtgatctcgcccactgtcctccagcc 120
           ||||||||||| || ||||||||||||||||||||| ||||| |||||||| ||||||||
Clone: 61  ctttgagcccaggaggttgaggctacagtgagtggtaatctc-cccactgtactccagcc 119


Fragm: 121 tagcgacagagcatgatcctatctcca--aaaaacatttttaagaa--actgagtagacc 176
           | | || |||||  || ||||||||||  || || |     || ||  ||||||||||| 
Clone: 120 tggtgaaagagcgagaccctatctccaggaagaagaaaaaaaaaaacaactgagtagaca 179


Fragm: 177 ggtgtcctggtggcatgataggtcctgggtcccctcccagatgtgtgaccttggacaggt 236
            | || ||||||||||||||||||||  |||||||||| | | ||||||||||| ||| |
Clone: 180 agagttctggtggcatgataggtcctaagtcccctcccggttctgtgaccttggtcagat 239


Fragm: 237 gacttttcctttggacctcagtgaccctatctgagtgagaaaagggtggtggggaggcag 296
           |||||||||| |||||||||||| ||  |||||||||||||||| | ||||||||||   
Clone: 240 gacttttcctgtggacctcagtgtcctcatctgagtgagaaaagcgcggtggggaggtga 299


Fragm: 297 atctttgagtctaagcggtgtagaagccgcgtctgaaaagccatactcagggctccaagt 356
           |||||  |||||| || |||||| ||||||||||||||||||||||||||||||||||||
Clone: 300 atcttccagtctacgcagtgtaggagccgcgtctgaaaagcca----ca----------- 359


Fragm: 357 ccagcacacagtcccagcagggcccggcagga-ggccagggcagcaaaggcatcaggtcc 415
           ||||| |||||||||||||||||||||  ||  ||||||||| ||| |||||||||||||
Clone: 345 ccagctcacagtcccagcagggcccggtggggcggccagggcggcacaggcatcaggtcc 419


Fragm: 416 caacctccttccctctttgcccgctctcAGACCAAGGAGTTCATCTTCTCGGAGCTGCTG 475
           | |||||||||||||||||||  ||| |||||||||||||||||||||||||||||||||
Clone: 405 ccacctccttccctctttgcctactcgcAGACCAAGGAGTTCATCTTCTCGGAGCTGCTG 479



44

Fragm: 476 TCCAACCTGTACTCACGTGGGGACCAGAAAACGCTGATGGAAGAGTCGGCAGAGCAGGCA 535
            |||||||||||||  ||||||||||||| ||||||||||| |||||||| |||||||||
Clone: 465 GCCAACCTGTACTCGTGTGGGGACCAGAACACGCTGATGGAGGAGTCGGCGGAGCAGGCA 539


Fragm: 536 CAGTGGCGCGACGAGATGCTGCGCATGTACCACGTGCTGAAGGAGGCACTCGGCATCATC 595
           ||| ||||||||||||||||||||||||||||||  ||||||||||| ||| ||||||||
Clone: 525 CAGCGGCGCGACGAGATGCTGCGCATGTACCACGCACTGAAGGAGGCGCTCAGCATCATC 599


Fragm: 596 GGCGACATCAACACGACCACC 616
           |||||||||||||||||||||
Clone: 585 GGCGACATCAACACGACCACC 605

Vergleich der kodierenden Sequenz des 700 bp Fragmentes mit der entsprechenden Dynamin-Segment auf Aminosäureebende

Dynamin  TKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGNINTTT
Fragment ----------S----R---K-----------W---------V-----G---D-----

Da, wie man von der Abbildung 16 entnehmen kann, die Banden sehr nah beieinander im Agarosegel laufen, wurde, um eine Bestätigung zu erhalten, dass auch tatsächlich diese dynaminbeinhaltende Sequenz im Tumorgewebe amplifiziert ist, eine Hybridisierung des klonierten Fragments gegen die auf eine Membran geblottete RAPD PCR vorgenommen. Auf der Abbildung 17,wo das Hybridisierungsresultat dargestellt wird, sind zwei Banden zu sehen, deren Intensität bei allen sechs Patientinnen im entsprechendem Tumormaterial stärker war. Die obere Bandeentspricht dem 700bp und die untere Bande dem 500bp langem Fragment. Die Gleichmässigkeit der Ergebnisse führt zur Annahme, dass die kleinere Bande eine Teilsequenz der grösseren ist und dass der Primer bei der Synthese sich früher vom Template abgekoppelt hat.


45

Abb. 16: Amplifikation von sechs Tumorgewebe- und Leukozyten-DNA-Paaren mit den STARK und TELO3 Primer. Sichtbar sind drei Unterschide mit einem Molekulargewicht von 500, 700 und 1000bp.

Abb. 17: Die Hybridisierung ergab zwei Banden für jede Probe. Die Banden aus dem Tumorgewebe zeichnen sich durch eine höhere Intensität aus, was für eine Amplifikation der entsprechenden Sequenzen spricht. Die obere Bande entspricht dem 700bp langem Fragment, die untere dem 500bp langem Fragment.


© Die inhaltliche Zusammenstellung und Aufmachung dieser Publikation sowie die elektronische Verarbeitung sind urheberrechtlich geschützt. Jede Verwertung, die nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung. Das gilt insbesondere für die Vervielfältigung, die Bearbeitung und Einspeicherung und Verarbeitung in elektronische Systeme.

DiML DTD Version 2.0
Zertifizierter Dokumentenserver
der Humboldt-Universität zu Berlin
HTML - Version erstellt am:
Wed Sep 5 16:50:29 2001