[Seite 44↓]

4  Ergebnisse

4.1 Die Rolle der Glukose-6-phosphat Isomerase als Autoantigen bei Patienten mit RA

4.1.1 CD4+ Zellantwort bei Patienten mit rheumatoider Arthritis

Hier soll untersucht werden, ob Patienten mit RA CD4+ T-Zellen besitzen, die ein Epitop der G6PI erkennen. Nach Restimulation der CD4+ T-Zellen mit G6PI soll die Expression von IFN-γ und TNF-α durchflusszytometrisch bestimmt werden. Blut oder mononukleäre Zellen aus dem peripherem Blut (PBMC) von RA-Patienten oder gesunden Spendern wurden für 6 Stunden in Anwesenheit von anti-CD28, einem Antikörper, der als Agonist auf CD28 wirkt und ein kostimulatorisches Signal liefert, restimuliert. Neben anti-CD28 wurden die Zellen zusätzlich mit rhG6PI, Hühner Ovalbumin (Ova), rekombinantem outer surface protein A (OspA) von Borrelia burgdorferi oder dem Superantigen Staphylokokken Enterotoxin B (SEB) restimuliert. Das OspA Protein ist ein Oberflächenprotein der Spirochete B. burgdorferi. SEB ist ein Superantigen, welches die T-Zellen aktivieren kann, die bestimmte Vβ Domänen exprimieren und hier als Positivkontrolle eingesetzt wurde. Nach 6 Stunden Restimulation wurde die Expression von TNF-α oder IFN-γ der CD4+ Zellen durchflusszytometrisch bestimmt. 4.1 zeigt beispielhaft die Auswertung einer Messung am FACS, die mit dem Blut eines RA-Patienten durchgeführt wurde. Dargestellt sind nur die CD4+ Zellen. Alle Proben mit Ausnahme der Proben, die mit SEB restimuliert wurden, zeigten ein ähnliches Bild. Nur sehr wenige CD4+ Zellen waren aktiviert und exprimierten TNF-α oder IFN-γ. Die Frequenz der CD69+ TNF-α oder IFN-γ produzierender CD4+ Zellen schwankte zwischen 0,01% und 0,05% und war unabhängig davon, ob die Zellen neben anti-CD28 mit einem weiteren Antigen stimuliert wurden. Nur nach Restimulation mit OspA waren die Frequenzen mit 0,2% TNF-α und 0,15% IFN-γ produzierender CD4+/CD69+ Zellen etwas höher. Daneben exprimierten die CD4+ Zellen, die zusätzlich mit SEB restimuliert wurden, mit 8,38% TNF-α und 4,01% IFN-γ produzierender CD4+/CD69+ Zellen große Mengen beider Zytokine. In diesem Patienten konnten keine CD4+ T-Zellen identifiziert werden, die mit der Sezernierung von TNF-α und IFN-γ nach Restimulation mit G6PI antworteten. In Abbildung 4.2 ist die Frequenz IFN-γ produzierender CD4+CD69+ Zellen aller untersuchten Patienten mit RA und gesunden Spendern dargestellt, deren Blut oder PBMC mit den beschriebenen Antigenen restimuliert wurden. Die Zellen von 13 Patienten mit RA und 5 gesunden Spendern wurden


[Seite 45↓]

Abb. 4.1: Kein Nachweis G6PI spezifischer T-Helferzellen im Blut von RA-Patienten. Blut eines Patienten mit rheumatoider Arthritis wurde für 6 Stunden mit anti-CD28 alleine oder zusätzlich mit rhG6PI, dem Superantigen SEB (Staphylokokken Enterotoxin B), dem Ova-Protein (Ovalbumin) oder rekombinanten OspA (outer surface protein A) restimuliert. 2 Stunden nach Beginn der Restimulation wurde die Zytokinsekretion durch Zugabe von Brefeldin A gestoppt. Nach 6 Stunden wurden die Zellen gegen CD4 und CD69 gefärbt, fixiert und intrazellulär gegen TNF-α und IFN-γ gefärbt und im FACS analysiert. Gezeigt ist eine beispielhafte Messung eines von insgesamt 13 untersuchten Patienten.

ausschließlich mit anti-CD28 restimuliert. Im Mittel produzierten 0,01% der CD4+ Zellen der RA-Patienten und 0,06% der CD4+ Zellen gesunder Spender IFN-γ. Wurden die Zellen zusätzlich mit rhG6PI restimuliert, exprimierten im Mittel 0,04% der CD4+ Zellen der 13 RA-Patienten und 0,18% der CD4+ Zellen der 8 gesunden Spender IFN-γ. Obwohl die Frequenz der IFN-γ produzierenden Zellen in den gesunden Spendern höher war, war dieser Unterschied nicht signifikant. Die Analyse mit dem Mann-Whitney Test lieferte ein P>0,05. Die Restimulation mit Ovalbumin zeigte ein vergleichbares Ergebnis. Ungefähr 0,03% der CD4+ Zellen der RA-Patienten und 0,09% der CD4+ Zellen der gesunden Spender sezernierten im Mittel IFN-γ. Nach der Restimulation mit OspA exprimierten im Mittel 0,1 % der CD4+ Zel[Seite 46↓]len der RA-Patienten und sogar 0,5% der CD4+ Zellen der gesunden Spender IFN-γ. Auch dieser Unterschied war nicht signifikant, da insgesamt nur die Zellen von 4 gesunden Spendern mit OspA restimuliert wurden. Einer dieser Spender wies eine Frequenz von 1,86% IFN‑γ produzierender CD4+ Zellen auf.

Abb. 4.2: Keine unterschiedliche IFN-γ Produktion der T-Helferzellen von RA-Patienten und gesunden Spendern nach Restimulation mit unterschiedlichen Antigenen. Blut oder mononukleäre Zellen aus dem peripheren Blut (PBMC) von Patienten mit rheumatoider Arthritis oder von gesunden Spendern wurde für 6 Stunden mit anti-CD28 alleine oder zusätzlich mit rhG6PI, dem Superantigen SEB (Staphylokokken Enterotoxin B) oder den irrelevanten Antigenen Ovalbumin (Ova) und dem rekombinanten OspA (outer surface protein A) restimuliert. 2 Stunden nach Beginn der Restimulation wurde die Zytokinsekretion durch Zugabe von Brefeldin A gestoppt. Nach 6 Stunden wurden die Zellen gegen CD4 und CD69 gefärbt, fixiert und intrazellulär gegen IFN-γ gefärbt und im FACS analysiert. Jede Messung ist als % IFN-γ produzierender CD4+CD69+ Zellen dargestellt. Zusätzlich sind alle Messungen einer Gruppe auch gemittelt dargestellt.

Alle anderen gesunden Spender oder auch RA-Patienten zeigten keine Frequenzen IFN-γ produzierender CD4+ Zellen, die höher als 0,22% waren. Insgesamt waren die gemessenen Frequenzen IFN-γ produzierender CD4+ Zellen sehr gering unabhängig davon, ob die Zellen mit anti-CD28 alleine oder zusätzlich noch mit rhG6PI, Ova oder OspA restimuliert wurden. Dass die CD4+ Zellen in der Lage waren, IFN-γ zu produzieren, zeigte die Restimulation mit SEB. Die 13 RA-Patienten zeigten im Mittel eine Frequenz von 2,47% und die 8 gesunden Spender von 2,75% IFN-γ produzierender CD4+ Zellen nach Restimulation mit SEB. Ein ähnliches Bild zeichnete sich auch für die Produktion von TNF-α ab. Abb. 4.3 fasst die Ergebnisse zusammen. Hier produzierten im Mittel 5,91% der CD4+CD69+ Zellen der RA-Patienten und 7,24% der gesunden Spender TNF-α nach Restimulation mit SEB. Die Frequenzen für die Zellen, die mit anti-CD28 alleine oder zusätzlich noch mit den anderen Antigenen restimuliert wurden, lag wieder deutlich niedriger. Die Restimulation mit anti-CD28 lieferte eine mittlere Frequenz von 0,03% für die RA-Patienten und 0,07% für die gesunden Spender. Diese Frequenz erhöhte sich nur geringfügig, wenn die Zellen zusätzlich mit rhG6PI stimuliert wurden. Die mittlere Frequenz von TNF-α produzierenden CD4+CD69+ Zellen betrug 0,10% bei den RA-Patienten und 0,12% bei den gesunden Spendern.


[Seite 47↓]

Abb. 4.3: Keine unterschiedliche TNF-α Produktion der T-Helferzellen von RA-Patienten und gesunden Spendern nach Restimulation mit unterschiedlichen Antigenen. Blut oder mononukleäre Zellen aus dem peripheren Blut (PBMC) von Patienten mit rheumatoider Arthritis oder von gesunden Spendern wurde für 6 Stunden mit anti-CD28 alleine oder zusätzlich mit rhG6PI, dem Superantigen SEB (Staphylokokken Enterotoxin B), dem Ovalbumin (Ova) oder rekombinanten OspA (outer surface protein A) restimuliert. 2 Stunden nach Beginn der Restimulation wurde die Zytokinsekretion durch Zugabe von Brefeldin A gestoppt. Nach 6 Stunden wurden die Zellen gegen CD4 und CD69 gefärbt, fixiert und intrazellulär gegen TNF-α gefärbt und im FACS analysiert. Jede Messung ist als % TNF-α produzierender CD4+CD69+ Zellen dargestellt. Zusätzlich sind alle Messungen einer Gruppe auch gemittelt dargestellt.

Dieser Unterschied war erneut nicht signifikant (P>0,15). Auch die Restimulation mit OspA lieferte im Mittel Frequenzen von unter 0,18% TNF-α produzierender CD4+CD69+ Zellen bei den RA-Patienten und unter 0,11% bei den gesunden Spendern nach Restimulation mit Ovalbumin. Es konnte kein Unterschied in der Frequenz autoreaktiver G6PI-spezifischer CD4+ T-Zellen im Blut von Patienten mit RA oder gesunden Spendern festgestellt werden. Insgesamt ließen sich nur sehr wenige CD4+ T-Zellen überhaupt mit rhG6PI restimulieren.

4.1.2 Die humorale Immunantwort gegen humane und Kaninchen Glukose-6-phosphat Isomerase bei RA-Patienten

Serum von 61 RA-Patienten, sowie von 21 Patienten, mit anderen rheumatischen Erkrankungen, wie z.B. ankylosierende Spondylitis, Kollagenose, Vaskulitis und Psoriasis Arthritis, und 32 gesunden Spendern wurden im ELISA auf die Anwesenheit von anti-G6PI Antikörpern untersucht. Zum Nachweis der anti-G6PI Antikörper wurde rhG6PI und kommerziell erhältliche Kaninchen G6PI verwendet, die aus dem Muskel von Kaninchen aufgereinigt wurde. Die Kaninchen G6PI Präparation wurde verwendet, da angeblich 64% der RA-Patienten erhöhte Antikörpertiter gegen Kaninchen G6PI entwickelten (Schaller et al. (2001)).

Im linken Teil der Abb. 4.4 sind die Ergebnisse für den ELISA gegen die humane G6PI Präparation dargestellt. Unter den 32 gesunden Spendern wiesen 2 Spender (6,25%) einen erhöhten Antikörpertiter gegen rhG6PI auf. Keiner der 21 Patienten mit anderen rheumatischen Erkrankungen entwickelte erhöhte Antikörpertiter gegen rhG6PI. Auch bei den RA-Patienten entwickelten nur 2 von 61 Patienten (3%) erhöhte Antikörpertiter. Dieses Ergebnis wider[Seite 48↓]spricht der oben erwähnten Studie, wo 64% der RA-Patienten erhöhte Antikörpertiter gegen Kaninchen G6PI entwickelten.

Die eben beschriebenen Experimente wurden mit einer kommerziell erhältlichen Kaninchen G6PI Präparation wiederholt. Die Ergebnisse sind im rechten Teil der Abb. 4.4 dargestellt. Nur ein Serum der gesunden Spender enthielt einen erhöhten Antikörpertiter gegen G6PI. 9 der 21 Seren der Patienten mit anderen rheumatischen Erkrankungen (42%) zeigten erhöhte Antikörperkonzentrationen, die gegen G6PI gerichtet waren. Auch in den RA-Patienten entwickelten 15 der 61 (25%) Patienten eine erhöhte Konzentration von Antikörpern gegen G6PI. Diese Ergebnisse zeigen, dass abhängig von der Präparation unterschiedliche Titer bestimmt werden konnten.

Abb. 4.4: Einige RA-Patienten entwickeln Antikörper gegen eine kommerzielle Kaninchen G6PI Präparation nicht aber gegen rekombinante humane G6PI. Serum von 61 Patienten mit RA, 21 Patienten mit anderen rheumatischen Erkrankungen (Vaskulitis, ankylosierende Spondylitis, Kollagenosen und Psoriasis Arthritis), sowie Serum von 32 gesunden Spendern wurde im ELISA auf die Anwesenheit von anti-G6PI Antikörpern untersucht. Dabei wurden die Seren 1:50 verdünnt und gegen die rekombinante humane G6PI Präparation (linke Abbildung) oder gegen die kommerziell erhältliche G6PI Präparation aus Kaninchenmuskel (rechte Abbildung) getestet. Ein Serum wurde als positiv auf die Anwesenheit von anti-G6PI Antikörpern bewertet, wenn die Absorption bei 450nm größer war als die mittlere Absorption der gesunden Spender plus zwei Standardabweichungen. Die durchgezogene Linie markiert diese Absorption.

4.1.3 Immunoblot- und MALDI-Analyse eines potentiellen Autoantigens bei rheumatoider Arthritis

Der vorige Abschnitt zeigte, dass Patienten mit RA oder anderen rheumatischen Erkrankungen keine erhöhten Antikörpertiter gegen rekombinante humane G6PI im Vergleich zu den gesunden Spendern entwickelten. Im Gegensatz dazu enthielten 25 bzw. 42% der Seren von Patienten mit RA und anderen rheumatischen Erkrankungen erhöhte anti-G6PI-IgG Konzentrationen bei Verwendung der Kaninchen G6PI Präparation. Um diesen Widerspruch aufzuklä[Seite 49↓]ren, wurden beide Präparationen in einem 12%igen SDS-Polyacrylamidgel elektrophoretisch aufgetrennt und die Proteine mit Coomassie Blau angefärbt.

Abb. 4.5 zeigt, dass nach Auftrennung der rhG6PI Präparation im SDS-Polyacrylamidgel ausschließlich eine große Bande bei ungefähr 55 kDa sichtbar wurde. 55 kDa ist die vorhergesagte Größe von G6PI. Die Präparation des kommerziellen Kaninchen G6PI zeigte bei 55kDa auch eine große Bande. Zusätzlich zu dieser Bande wurden kontaminierende Banden bei 85kDa, 60kDa, 40kDa, 35kDa und 33kDa sichtbar. Das Serum der Patienten, die im ELISA gegen die kommerzielle Präparation der Kaninchen G6PI positiv auf die Anwesenheit von anti-G6PI Antikörper getestet wurden, wurden auch im Immunoblot untersucht.

In Abbildung 4.5 ist beispielhaft ein Immunoblot mit dem Serum eines Patienten mit Vaskulitis dargestellt.

Abb. 4.5: SDS-PAGE der G6PI Präparationen und Immunoblot Analyse eines Patienten Serums. Die Präparationen der rekombinanten humanen G6PI und der kommerziell erhältlichen Kaninchen G6PI wurden in einem 12%igen SDS-Polyacrylamidgel elektrophoretisch aufgetrennt und die Proteine mit Coomassie Blau angefärbt. Zusätzlich wurden beide Präparationen auf Nitrocellulose transferiert. Das Serum einiger Patienten, die im ELISA erhöhte Antikörpertiter gegen das Kaninchen G6PI aufwiesen, wurden im Immunoblot auf die Spezifität ihrer Antikörper gegen G6PI getestet. Die Bindung von Antikörpern an eines der aufgetrennten Proteine beider Präparationen wurde mit einem Peroxidase-konjugiertem anti-human IgG Sekundärantikörper detektiert. Ein Beispiel ist gezeigt.

Nach der Entwicklung des Immunoblots konnte die Bindung von IgG-Antikörpern an ein Protein der Kaninchen G6PI-Präparation beobachtet werden, welches ein Molekulargewicht von ca. 40kDa besaß. Keine Bindung von Antikörpern konnte dagegen an die G6PI beider Präparationen beobachtet werden.


[Seite 50↓]

Um das Protein der kommerziell erhältlichen G6PI Präparation zu identifizieren, wurde die entsprechende Bande bei 40kDa ausgeschnitten. Das Protein wurde mit Trypsin verdaut. Anschließend wurde ein peptide mass fingerprint (PMF) mittels einer MALDI-MS (matrix assisted laser desorption – ionization mass spectrometry) Messung erstellt.

In Abbildung 4.6 ist das aufgezeichnete Massenspektrum dargestellt. Insgesamt wurden in diesem Massenspektrum 24 unterschiedliche Peptide nachgewiesen. Zwei dieser Peptide lieferten nur sehr geringe Signale und wurden für die anschließende Datenbanksuche nicht berücksichtigt. Das Protein wurde mit Hilfe der Massen der detektierten Peptide über das Programm Ms-Fit (http://falcon.ludwig.ucl.ac.uk-/ucsfhtml3.2/msfit.htm) bestimmt. Bei diesem Protein handelte es sich um die M-Kette der Kaninchen Kreatinkinase (CK-M).

Abb. 4.6: Massenspektrum eines potentiellen Autoantigens bei RA. Nach Auftrennung der Kaninchen G6PI Präparation mittels SDS-Polyacrylamidgelelektrophorese wurde eine Bande bei ca. 40kDa ausgeschnitten. Dieses Protein wurde zuvor im Immunoblot von IgG-Antikörpern aus dem Serum einiger Patienten mit RA und anderen rheumatischen Erkrankungen spezifisch gebunden. Das Protein wurde mit Trypsin verdaut und einem peptide mass fingerprint (PMF) mittels einer MALDI-MS (matrix assisted laser desorption – ionization mass spectrometry) Messung unterzogen. Die dargestellten Signale stellen die detektierten Peptide dar. Die Zahlen an der Spitze der Signale geben die Masse der detektierten Peptide in Da an. Es wurden keine Peptide berücksichtigt, die kleiner als 500 Da waren. Insgesamt wurden 21 der 24 gemessenen Peptide für die Analyse des PMF herangezogen. Die MALDI-MS Analyse wurde von Peter Jungblut und Monika Schmidt am MPI für Infektionsbiologie durchgeführt.

In Tab. 4.1 wurden die Massen der detektierten Peptide und deren Abschnitte in der Sequenz der M-Kette der Kaninchen Kreatinkinase dargestellt. Die detektierten Peptide im Massen[Seite 51↓]spektrum deckten 64% dieser Sequenz ab. Bei zwei der 22 Peptide konnten Modifikationen an den Cysteinen festgestellt werden. Es handelte sich dabei um ein Peptid, welches die Aminosäuren 139-148 der M-Kette der Kaninchen Kreatinkinase umfasste, sowie dem Peptid, welches die Aminosäuren 267-292 umfasste.

Tab. 4.1: Liste der detektierten Peptide der M-Kette der Kreatinkinase nach MALDI-MS und Datenbankanalyse durch MS-Fit. Die nach Trypsinverdau und MALDI-MS gemessenen Massen der detektierten Peptide im Masenspektrum wurden einer Datenbanksuche mit dem Programm MS-Fit (http://falcon.ludwig.ucl.ac.uk-/ucsfhtml3.2/msfit.htm) unterzogen. Die Analyse identifizierte das Protein als die M-Kette der Kaninchen Kreatinkinase. Dargestellt wurden die Massen der einzelnen Peptide in Da (m/z), sowie der Bereich und die Sequenz der Kreatinkinase, die das entsprechende Peptid abdeckt. Außerdem wurden Modifikationen an den entsprechenden Peptiden dargestellt. Insgesamt deckten die detektierten Peptide 64% der Sequenz der M-Kette der Kaninchen Kreatinkinase ab.

m/z

Start

Ende

Peptid Sequenz

Modifikationen

550.33

248

251

(K)EVFR(R)

 

683.39

173

177

(K)YYPLK(S)

 

759.37

210

215

(R)DWPDAR(G)

 

778.45

260

265

(K)IEEIFK(K)

 

907.50

308

314

(K)FEEILTR(L)

 

948.56

33

40

(K)VLTPDLYK(K)

 

983.49

216

223

(R)GIWHNDNK(S)

 

986.54

97

105

(R)HGGFKPTDK(H)

 

1083.57

108

116

(K)TDLNHENLK(G)

 

1196.54

16

25

(K)SEEEYPDLSK(H)

 

1201.60

139

148

(K)GYTLPPHCSR(G)

1Cys-am

1231.65

87

96

(K)DLFDPIIQDR(H)

 

1302.65

370

381

(K)GQSIDDMIPAQK(-)

 

1507.81

157

170

(K)LSVEALNSLTGEFK(G)

 

1530.73

117

130

(K)GGDDLDPHYVLSSR(V)

 

1643.84

224

236

(K)SFLVWVNEEDHLR(V)

 

1785.83

117

132

(K)GGDDLDPHYVLSSRVR(T)

 

1785.83

342

358

(R)LGSSEVEQVQLVVDGVK(L)

 

2008.95

321

341

(R)GTGGVDTAAVGSVFDISNADR(L)

 

2165.07

320

341

(K)RGTGGVDTAAVGSVFDISNADR(L)

 

2941.32

267

292

(K)AGHPFMWNEHLGYVLTCPSNLGTGLR(G)

1Cys-am

3644.74

178

209

(K)SMTEQEQQQLIDDHFLFDKPVSPLLLASGMAR(D)

 

4.1.4 Die humorale Immunantwort gegen die M-Kette der Kreatinkinase bei RA-Patienten

Nun sollte untersucht werden, ob die Seren der RA-Patienten, Patienten mit anderen rheumatischen Erkrankungen oder der gesunden Spender erhöhte anti-CK-M Konzentrationen auf[Seite 52↓]wiesen. Die M-Kette der Kaninchen Kreatinkinase wurde an ELISA Platten gebunden und erneut mit den unterschiedlichen Seren inkubiert.

Abb. 4.7: Detektion von Autoantikörpern gegen die M-Kette der Kreatinkinase. Serum von 61 Patienten mit RA, 21 Patienten mit anderen rheumatischen Erkrankungen sowie Serum von 32 gesunden Spendern wurde 1:50 verdünnt und im ELISA auf die Anwesenheit von anti-Kreatinkinase M-Kette Antikörpern untersucht. Ein Serum wurde als positiv auf die Anwesenheit von anti-CK-M Antikörpern bewertet, wenn die Absorption bei 450nm größer war als die mittlere Absorption der gesunden Spender plus zwei Standardabweichungen. Die durchgezogene Linie markiert diese Absorption.

In Abb. 4.7 werden die Ergebnisse dargestellt. Ein gesunder Spender zeigte eine erhöhte Konzentration von Antikörpern gegen die M-Kette der Kreatinkinase im Serum. In 4 von 21 Patienten mit Erkrankungen, die zum rheumatischen Formenkreis gehören, und 10 von 61 RA-Patienten wurden erhöhte Konzentration von anti-Kreatinkinase Antikörpern gemessen. Unter diesen 10 RA-Patienten waren auch 4 Patienten deren Antikörper zuvor auch die Kaninchen G6PI Präparation erkannt hatten. Damit konnte gezeigt werden, dass einige Patienten mit RA aber auch mit anderen rheumatischen Erkrankungen Antikörper gegen die M-Kette der Kreatinkinase ausbildeten. Die gegen G6PI gerichteten Antikörper aus der Kaninchen Präparation waren tatsächlich gegen Kontaminanten in dieser Präparation gerichtet.


[Seite 53↓]

4.2  Die Induktion und Beschreibung einer Arthritis mit Glukose-6-phosphat Isomerase in der Maus

4.2.1 Arthritisinduktion in der Maus durch Immunisierung mit humaner Glukose-6-phosphate Isomerase

Für den Versuch einer Arthritisinduktion mit Glukose-6-phosphat Isomerase wurden unterschiedliche Mausstämme ausgewählt. Der DBA/1 Stamm und der B10.Q Stamm sind suszeptibel für die Kollagen induzierte Arthritis (CIA) und exprimieren beide den MHC-Haplotyp H2-q. Der Stamm B10.A exprimiert H2-k und ist sonst dem B10.Q Stamm sehr ähnlich. Daneben wurde der Stamm SWR gewählt, der auch H2-q exprimiert. Der DBA/2 Stamm ähnelt dem DBA/1 Stamm genetisch am stärksten, exprimiert jedoch H2-d. Außerdem wurde der AKR Stamm ausgewählt, der nach einer Infektion mit B. burgdorferi eine Arthritis entwickelt.

Tab. 4.2: Arthritisinduktion durch Immunisierung mit rhG6PI. Mäuse unterschiedlicher Stämme wurden mit rekombinanter humaner G6PI in komplettem Freundschen Adjuvans an der Schwanzbasis immunisiert und über einen Zeitraum von mindestens 30 Tagen auf klinische Zeichen einer Arthritis beobachtet.

Stamm

MHC-Haplotyp

Inzidenz

BALB/c

H2-d

0/8

C57BL/6

H2-b

0/8

DBA/2

H2-d

0/11

AKR

H2-k

0/8

B10.A

H2-k

0/8

DBA/1x C57BL/6

H2-q/b

0/5

SWR

H2-q

0/10

B10.Q

H2-q

0/8

DR4mix

HLA-DR0401

0/8

DR4-Kim

HLA-DR0401

1/11

DBA/1

H2-q

311/327

Zusätzlich wurden die Stämme BALB/c und C57/BL6 ausgewählt, die standardmäßig bei vielen Fragestellungen im Labor benutzt werden. Neben den reinen Wildtypinzuchtstämmen wurden auch HLA-DR4 transgene Tiere ausgewählt. Dazu zählte ein DR4 transgener Stamm auf einem Mischhintergrund (DR4mix) und ein Stamm auf DBA/1 Hintergrund, der eine Chimäre aus dem endogenen Maus MHC-II und aus dem humanen HLA-DR0401 exprimiert (DR4-Kim). Außerdem wurde versucht, in der F1 Generation einer Kreuzung von DBA/1 Mäusen und C57/BL6 Mäusen, eine Arthritis zu induzieren. Die Mäuse wurden mit rekombinanten humanen G6PI in komplettem Freundschen Adjuvans (CFA) subkutan an der [Seite 54↓]Schwanzbasis immunisiert und über einen Zeitraum von mindestens 30 Tagen auf klinische Zeichen einer Arthritis beobachtet (Tab. 4.2). Zur Kontrolle wurden diese Mäuse auch ausschließlich mit CFA immunisiert (Daten nicht gezeigt). Über 95% der DBA/1 Tiere und eine Maus des DR4-Kim Stammes entwickelten eine Arthritis nach G6PI Immunisierung nicht aber nach Immunisierung nur mit CFA.

Abb. 4.8: Arthritisinduktion bei DBA/1 Mäusen. DBA/1 Mäuse wurden mit rekombinanter humaner G6PI in CFA oder mit PBS/CFA subkutan an der Schwanzbasis immunisiert. PBS/CFA immunisierte Mäuse zeigten 15 Tage nach Immunisierung keine klinischen Anzeichen einer Arthritis in den Vorder- (links oben) und Hinterpfoten (links unten). Im Gegensatz dazu entwickelten DBA/1 Mäuse nach subkutaner Immunisierung mit rhG6PI/CFA eine schwere symmetrische Arthritis in den Vorder- (rechts oben) und Hinterpfoten (rechts unten).

Das Allgemeinbefinden der klinisch unauffälligen Mäuse schien normal. Die Tiere zeigten die gleiche Aktivität bezüglich Bewegung und Nahrungsaufnahme wie Tiere ihres Stammes, die nicht immunisiert wurden, bzw. die ausschließlich mit CFA immunisiert wurden. Das Fell dieser Mäuse war glatt anliegend und glänzend. DBA/1 Mäuse, die mit G6PI immunisiert wurden, zeigten eine massive Schwellung der Vorder- und Hinterläufe (Abb. 4.8). Bei den kranken Tieren war der Bewegungsdrang deutlich eingeschränkt. Einige Tiere verloren nach ein paar Tagen deutlich an Gewicht (Daten nicht gezeigt). Das Fell dieser Tiere wirkte im Vergleich zu nicht-immunisierten Tieren stumpf und struppig, was ein deutlicher Hinweis auf ein schlechtes Allgemeinbefinden der Tiere war. DBA/1 Mäuse, die nur mit CFA immunisiert wurden, zeigten über den gesamten Beobachtungszeitraum von 30 Tagen keine klinischen Anzeichen einer Arthritis.


[Seite 55↓]

4.2.2  Klinischer Verlauf nach Arthritisinduktion mit humaner Glukose-6-phosphat Isomerase

Nach Immunisierung mit rhG6PI entwickelten über 95% der DBA/1 Mäuse eine periphere symmetrische Arthritis in den Vorder- und Hinterpfoten. Die Tiere wurden nach Immunisierung über einen Zeitraum von 30 Tagen beobachtet und bezüglich klinischer Anzeichen einer Arthritis bewertet. Dabei wurde jede Pfote einer Maus einzeln bewertet und die klinischen Zeichen der Arthritis in drei Schweregrade unterteilt. Der Grad 0 entsprach einer gesunden, klinisch unauffälligem Pfote. Bei einem Grad 1 zeigten die Pfoten eine leichte Schwellung und eine leichte Rötung. Der Grad 2 war der Maximalbefund. Die Pfoten waren stark angeschwollen und massiv gerötet. Eine Maus konnte einen maximalen Arthritisgrad von 8 erreichen.

Abb. 4.9: Klinischer Verlauf der G6PI induzierten Arthritis. 27 DBA/1 Mäuse wurden mit rhG6PI immunisiert und auf die Entwicklung einer Arthritis in den Vorder- und Hinterpfoten beobachtet. Jede Pfote einer Maus wurde einzeln bewertet. Dabei wurde die Arthritis in drei Grade unterteilt. Grad 0: klinisch unauffällig, Grad 1: leichte Schwellung und Rötung, Grad 2: Maximalbefund – massive Schwellung und Rötung. Die Bewertung der 27 Tiere zu jedem Zeitpunkt wurde gemittelt und als Mittel mit SEM dargestellt.

Die Abb. 4.9 zeigt den klinischen Verlauf von 27 DBA/1 Tieren, die mit rhG6PI immunisiert wurden und eine Arthritis entwickelten. Nach Immunisierung mit rhG6PI zeigten die DBA/1 Mäuse bis zum Tag 8 keine klinischen Anzeichen einer Arthritis. Die Entwicklung der Arthritis begann exakt 9 Tage nach Immunisierung, wobei erste leichte Schwellungen zu beobachten waren. Zwischen dem 12. und 14. Tag nach Immunisierung zeigten alle Tiere eine Schwellung der Vorder- und Hinterpfoten, die sich im Verlauf des Beobachtungszeitraumes nicht mehr verschlimmern sollte. Dabei wurde an Tag 14 ein mittlerer Arthritisgrad von 5,9±0,5 (Mittelwert ± Standardfehler) erreicht. Bis Tag 17 zeigten die Tiere im Mittel einen [Seite 56↓]schweren Verlauf der Arthritis mit Arthritisgraden, die, bis auf Tag 16, bei ≥5 lag. Ab Tag 18 verlief die Arthritis zunehmend milder und die Schwellung der Pfoten nahm langsam aber kontinuierlich ab. An Tag 20 wurde nur noch ein Arthritisgrad von 3,9 ± 0,6 gemessen. Am Ende des Beobachtungszeitraumes an Tag 30 lag der mittlere Arthritisgrad bei 2,2 ± 0,5. Tiere, die über einen längeren Zeitraum beobachtet wurden, z.B. über 60 Tage, zeigten nach 60 Tagen keine klinischen Anzeichen einer akuten Schwellung mehr.

4.2.3 Histologischer Verlauf nach Arthritisinduktion mit humaner Glukose-6-phosphat Isomerase

Neben dem klinischen Verlauf wurde die Entwicklung und der Verlauf der Arthritis in den DBA/1 Mäusen auch histologisch verfolgt. Dazu wurden zu unterschiedlichen Zeitpunkten nach Immunisierung mit rhG6PI DBA/1 Mäuse histologisch untersucht und das Ausmaß der Entzündung bestimmt. Zu diesem Zweck wurde, angelehnt an ein Skalierungssystem im Menschen, ein System etabliert, um einheitlich das Maß der Entzündung zu bestimmen Krenn et al. (2002). Die Abb. 4.10 zeigt die Einteilung für die Maus. Fünf unterschiedliche Kriterien wurden bei der Bewertung der Entzündung des Gelenkes berücksichtigt. Dazu zählten das Ausmaß der Synovitis, der Tenosynovitis, Periostitis, Periarthritis und das Ausmaß der Knorpel- und Knochendestruktion, hier nur mit Destruktion bezeichnet. Jedes dieser Kriterien wurde in vier Schweregrade unterteilt, welche am Beispiel der Synovitis erläutert werden. Der Grad 0 entspricht dabei dem Normalbefund einer gesunden Maus. Der Grad 1 ist durch eine geringfügige Stromaaktivierung, einer leichten Verbreiterung der Deckzellschicht und durch die Infiltration einiger inflammatorischer Zellen gekennzeichnet. Eine mäßiggradige Infiltration von Zellen und Verbreiterung der synovialen Deckzellschicht entspricht einer Synovitis des Grades 2. Das Vollbild eines destruierenden Pannus kennzeichnet den Grad 3 einer Synovitis. Um den Arthritisgrad einer Pfote bestimmen zu können, wurden die Werte jedes Kriteriums addiert und bildeten den Gesamtgrad einer Pfote. Der maximale Grad, der erreicht werden konnte, lag bei 15. In den vorderen Läufen entwickelten die Tiere hauptsächlich im Handgelenk, den metacarpalen Gelenken, sowie in den proximalen und distaleninterphalangealen Gelenken eine Arthritis. In den hinteren Läufen waren vor allem die tarsalen, Knöchel- und Kniegelenke betroffen. Abb. 4.11 zeigt den histologischen Verlauf der Arthritis nach Immunisierung mit rhG6PI. Pro Zeitpunkt wurden 3 Tiere für die histologische Bewertung verwendet. Der Arthritisgrad jeder Pfote wurde addiert und bildete den histologischen Arthritisgrad der Maus. Der maximale Grad, der erreicht werden konnte, lag bei 60, da jede Pfote


[Seite 57↓]

Abb. 4.10: Histologische Arthritisbewertung. HE-Färbungen (100fache Vergrößerung) von Gelenkschnitten der hinteren Pfoten von DBA/1 Mäusen, die mit rhG6PI immunisiert wurden und eine Arthritis entwickelten, bzw. gesunden mit PBS/CFA immunisierten DBA/1 Mäusen. Bei der Bewertung der Entzündung in den Gelenken der Mäuse wurden fünf Kriterien berücksichtigt: Synovitis, Tenosynovitis, Periostitis, Periarthritis und das Maß der Destruktion des Knorpels und des Knochens des betroffenen Gelenks. Jedes Kriterium wurde in vier unterschiedliche Schweregrade eingeteilt. Der Grad 0 entsprach dem Normalbefund bei einer gesunden Maus. Die Grade 1-3 entsprachen leichten, mittleren und schweren Befunden eines jeden Kriteriums. Die Punkte aller Kriterien wurden addiert und bildeten den Arthritisgrad des untersuchten Gelenks. 15 war somit der maximale Arthritisgrad, der bei einem Gelenk erreicht werden konnte.

wie oben beschrieben einen Grad von 15 erreichen konnte. Die Ergebnisse aller drei Mäuse pro Zeitpunkt wurden gemittelt. An den Tagen 3 und 6 konnten noch keine Infiltrationen von Zellen in den peripheren Gelenken beobachtet werden. An Tag 3 gab es ein Tier, welches in der hinteren rechten Pfote eine leichte Synovitis und Tenosynovitis des Grades 1 aufwies. Ansonsten wiesen alle Tiere an den Tagen 3 und 6 Normalbefunde auf. Erste histologische Veränderungen konnten an Tag 9 beobachtet werden. Der mittlere Arthritisgrad betrug zu diesem Zeitpunkt 13,7± 6,8. Dieser mittlere Arthritisgrad setzte sich vor allem aus einer [Seite 58↓]leichten bis mittleren Synovitis, Tenosynovitis und Periarthrtis zusammen. Knorpel- und Knochendestruktion sowie Perostitis lagen zu diesem Zeitpunkt noch nicht vor.

Abb. 4.11: Histologischer Verlauf der G6PI-induzierten Arthritis in DBA/1 Mäusen. DBA/1 Mäuse wurden mit rhG6PI immunisiert. Zu jedem Zeitpunkt wurden 3 Mäuse histologisch nach oben eingeführtem Arthritisskalierungssystem bewertet. Dabei wurde jede Pfote einzeln bewertet und die Ergebnisse addiert. Die Ergebnisse der einzelnen Mäuse pro Zeitpunkt wurden gemittelt und sind als Mittel mit SEM dargestellt.

Die Mäuse, die an den Tagen 12 und 15 untersucht wurden, hatten einen ähnlichen Befund. Bei einem mittleren Arthritisgrad von 35,3±6,8 an Tag 12 bzw. 35,6 ± 9,2 an Tag 15 lagen vor allem mittlere und schwere Synovitis, Tenosynovitis und Periarthritis vor. Dagegen konnte nur eine leichte bis mittlere Knorpel- und Knochendestruktion und vereinzelt leichte Perostitis festgestellt werden.

Abb. 4.12: Reparaturprozesse nach Arthritisinduktion mit rhG6PI. HE-Färbung (100fache Vergrößerung) eines Gelenkschnittes einer DBA/1 Maus nach Immunisierung mit rhG6PI und abgeklungener Arthritis an Tag 22 nach Immunisierung. Histologisch konnte kein aktiver inflammatorischer Prozess mehr beobachtet werden. Regenerative Prozesse wie Fibrose und Knorpelregeneration überwogen.

Wie im klinischen Verlauf wurde der höchste histologische Schweregrad der Arthritis zwischen den Tagen 12 und 15 festgestellt. An Tag 18 und 22 gab es kaum noch aktive inflam[Seite 59↓]matorische Prozesse in den betroffenen Gelenken. Der Arthritisgrad von 6,0 ± 2,0 an Tag 18 und 4,3 ± 3,4 an Tag 22 beruhte auf eine leichte Synovitis, Tenosynovitis und Periarthrtis. Zu diesen Zeitpunkten fanden vor allem Reparaturprozesse in Form von Fibrose und Knorpelregeneration, wie in Abb. 4.12 dargestellt, statt. An den Tagen 26 und 30 konnten nur noch Reparaturprozesse beobachtet werden.

4.2.4 Histologische Analyse nicht-suszeptibler Mausstämme nach Immunisierung mit Glukose-6-phosphat Isomerase

Von allen untersuchten Mausstämmen entwickelten nur die DBA/1 Mäuse klinische Zeichen einer Arthritis. Obwohl die anderen untersuchten Stämme keine klinische Zeichen eine Arthritis zeigten, konnte nicht ausgeschlossen werden, dass die Immunisierung mit rhG6PI zu einer Infiltration inflammatorischer Zellen der distalen Gelenke führte. Stämme, die keine klinischen Zeichen einer Arthritis zeigten, wurden an den Tagen 10, 20 und 30 nach Immunisierung histologisch untersucht. Zur Kontrolle wurden Tiere der unterschiedlichen Stämme auch mit PBS in CFA immunisiert und an Tag 40 histologisch untersucht. In Abb. 4.13 werden die HE-Färbungen der Gelenkschnitte eines Gelenks einer Hinterpfote der untersuchten Mausstämme an Tag 10 nach Immunisierung mit rhG6PI dargestellt. Zu diesem Zeitpunkt entwickelten die DBA/1 Mäuse schon eine massive Entzündung inklusive Knorpel- und Knochendestruktion. Die hier untersuchten Stämme zeigten dagegen keine Infiltration inflammatorischer Zellen in den Gelenkspalt. Die Synovialmembran war nicht aktiviert und nicht verdickt. Knorpel und Knochen zeigten keine Merkmale einer Destruktion. Auch das umliegende Gewebe war unauffällig. Nach oben eingeführter Arthritisskalierung erreichten alle Tiere der unterschiedlichen Stämme einen Arthritisgrad von 0 nach Immunisierung mit rhG6PI, was dem Normalbefund entsprach. Gleiches galt für die Kontrolltiere, die mit PBS in CFA immunisiert wurden. Auch die anderen Gelenke, die nicht in Abb. 4.13 dargestellt sind, waren unauffällig. Die Analyse der anderen Mausstämme an den Tagen 20 und 30 nach Immunisierung mit rhG6PI lieferte das gleiche Ergebnis (Daten nicht gezeigt). Die Immunisierung mit rhG6PI führte in den Stämmen B10.A, B10.Q, BALB/c, DR4mix und C57BL/6 nicht zu der Induktion einer Arthritis.


[Seite 60↓]

Abb. 4.13: Keine Infiltrate in den Gelenken der klinisch unauffälligen Mausstämme nach G6PI Immunisierung. Unterschiedliche Mausstämme wurden mit rhG6PI immunisiert, um eine Arthritis zu induzieren. Zu verschiedenen Zeitpunkten wurden die Gelenke der Vorder- und Hinterläufe der Mäuse histologisch untersucht. Gezeigt wird eine HE-Färbung (100fache Vergrößerung) der Gelenkschnitte einer hinteren Pfote von den Mausstämmen B10.A, B10.Q, AKR, DR4mix, BALB/c und C57BL/6 an Tag 10 nach Immunisierung mit G6PI in CFA. Zum Vergleich werden Gelenkschnitte der gleichen Mausstämme gezeigt 40 Tage nach Immunisierung mit PBS in CFA. Pro Zeitpunkt wurden zwei Tiere jedes Stammes untersucht. In keinem der Gelenke konnte eine Infiltration inflammatorischer Zellen beobachtet werden.


[Seite 61↓]

4.2.5  Histologische Analyse der inneren Organe und Wirbelsäule von DBA/1 Mäusen nach Arthritisinduktion

Die Immunisierung mit rhG6PI führte zu einer schweren Arthritis in DBA/1 Mäusen, die vom pathologischem Befund viele histologische Merkmale der RA im Menschen widerspiegelte. Neben der rheumatoiden Arthritis existieren noch andere Arthritiden wie z.B. die ankylosierende Spondylititis, bei der die Gelenke der Wirbelsäule befallen werden. Daneben existieren auch Autoimmunerkrankungen bei denen die inneren Organe betroffen sind, wie z.B. beim systemischen Lupus Erythematodis (SLE). Hier sollte untersucht werden, ob die Immunisierung mit rhG6PI auch zu einer Entzündung der inneren Organe oder der Wirbelsäule führt. Dazu wurden DBA/1 Mäuse mit rhG6PI immunisiert und eine Arthritis induziert.

Abb. 4.14: Keine Entzündung der inneren Organe und Wirbelsäule in der G6PI-induzierten Arthritis. DBA/1 Mäuse wurden mit rhG6PI immunisiert. An den Tagen 9, 12, 15, 18, 22, 26 und 30 nach Immunisierung wurden die inneren Organe und die Wirbelsäule von je drei Tieren histologisch untersucht. Gezeigt wird eine HE-Färbung (100fache Vergrößerung) von Schnitten der Milz, Leber, Herz, Lunge, Niere und Wirbelsäule einer DBA/1 Maus mit Arthritis an Tag 12 nach Immunisierung mit rhG6PI. Weder in den Gelenken der Wirbelsäule noch in den inneren Organen konnte eine inflammatorische Aktivität beobachtet werden.

An den Tagen 9, 12, 15, 18, 22, 26 und 30 wurden die inneren Organe und die Wirbelsäule von je drei Tieren histologisch untersucht. Zur Kontrolle wurden DBA/1 Mäuse mit PBS in CFA immunisiert. In Abb. 4.14 sind beispielhaft HE-Färbungen der inneren Organe und der [Seite 62↓]Wirbelsäule einer DBA/1 Maus an Tag 12 nach Immunisierung mit rhG6PI dargestellt. Zu den untersuchten Organen zählten die Milz, Lunge, Herz, Leber und Niere. In keinem dieser Organe konnte eine Infiltration inflammatorischer Zellen an Tag 12 nach Immunisierung beobachtet werden. Dieser Befund konnte auch an den anderen Tagen, an denen die Tiere untersucht wurden, und

in den Kontrolltieren beobachtet werden (Daten nicht gezeigt). Der Befund der Wirbelsäule war unauffällig. Die Immunisierung mit rhG6PI führte zu schweren Inflammation der distalen Gelenke der Vorder- und Hinterläufe. Die inneren Organe wie Leber, Niere, Herz, Milz und Lunge sowie die Wirbelsäule waren nicht betroffen.

4.2.6 Arthritisinduktion in DBA/1 Mäusen mit rekombinanter muriner Glukose-6-phosphat Isomerase

Die bisher beschriebenen Experimente zeigten, dass DBA/1 Mäuse nach Immunisierung mit rekombinanter humaner G6PI, also heterologer G6PI, eine schwere Arthritis entwickelten. Die Homologie zwischen humaner und muriner G6PI beträgt 88%. Hier sollte durch Immunisierung von DBA/1 Mäusen mit rekombinanter muriner G6PI versucht werden, eine Arthritis auch mit autologer G6PI zu induzieren. Nach Immunisierung wurden die Tiere über einen Zeitraum von 30 Tagen beobachtet. Zum Vergleich wurden DBA/1 Mäuse mit rhG6PI immunisiert.

In Abb. 4.15 sind die klinischen Verläufe beider Gruppen dargestellt.Wie in Kapitel 4.2.2 schon beschrieben, entwickelten die DBA/1 Mäuse 9 Tage nach Immunisierung mit rhG6PI erste klinische Anzeichen einer Arthritis. An Tag 12 erreichten diese Tiere einen maximalen mittleren klinischen Grad der Arthritis von 6,4 ± 0,6. Anschließend nahm der klinische Grad der Arthritis kontinuierlich ab und erreichte an Tag 30 einen Wert von 0,3 ± 0,3. In diesem Experiment lag die Inzidenz der mit rhG6PI immunisierten Tiere bei 100%. Auch die Tiere, die mit rmG6PI immunisiert wurden, entwickelten exakt nach 9 Tagen eine Arthritis. Die Inzidenz der Arthritis lag bei diesen Tieren bei 80%, da nur 8 von 10 Tieren erkrankten. Der klinische Verlauf der Arthritis ähnelte stark der rhG6PI immunisierten Gruppe. Zwischen den Tagen 9 und 10 nach Immunisierung war der klinische Verlauf zwischen beiden Gruppen fast deckungsgleich. An Tag 11 erreichten die mit rmG6PI immunisierten Tiere einen mittleren Arthritisgrad von 4,6 ± 1,1, der dann bis Tag 17 nur langsam auf 5,1 ± 0,8 anstieg. Die klinischen Verläufe zeigten keine signifikanten Unterschiede auf. Der Mann-Whitney Test lieferte immer P-Werte > 0,05. Beginnend vom Tag 18 nahm der Arthritisgrad der rmG6PI immuni[Seite 63↓]sierten Tiere kontinuierlich ab und erreichte an Tag 30 einen Arthritisgrad von 1,1 ± 0,3. Auch die murine G6PI ist in der Lage eine Arthritis in DBA/1 Mäusen zu induzieren.

Abb. 4.15: Murine G6PI induziert Arthritis in DBA/1 Mäusen. DBA/1 Mäuse wurden mit rekombinanter muriner G6PI (Quadrate) oder rekombinanter humaner G6PI (Dreiecke) immunisiert und über 30 Tage beobachtet. 8/10 DBA/1 Mäuse nach Immunisierung mit rmG6PI und 9/9 DBA/1 Mäuse nach Immunisierung mit rhG6PI entwickelten eine Arthritis (A). Der klinische Verlauf zwischen beiden Gruppen zeigte keine signifikanten Unterschiede auf, da der Mann-Whitney Test zu jedem Zeitpunkt P > 0,05 lieferte (B). Im klinischen Verlauf wurden nur die Tiere dargestellt, die auch erkrankten.

4.2.7 Arthritisinduktion in DBA/1 Mäusen mit denaturierter humaner Glukose-6-phosphat Isomerase

Die bisher gezeigte Arthritisinduktion wurde immer mit nativ aufgereinigter muriner oder humaner G6PI durchgeführt. Für G6PI wurde ein Rezeptor beschrieben, der auch auf Zellen des Immunsystems exprimiert wird und in der Lage sein soll, Immunantworten zu modulieren. Um zu untersuchen, ob auch bei der Arthritisinduktion mit rhG6PI die native Form der G6PI bei der Pathogenese der Arthritis eine Rolle spielt, sollte die Arthritisinduktion zwischen nativer und denaturierter rhG6PI verglichen werden. Dazu wurde G6PI durch Kochen denaturiert. DBA/1 Mäuse wurden anschließend mit nativer oder mit denaturierter rhG6PI immunisiert und der klinische Verlauf über einen Zeitraum von 30 Tagen beobachtet. Abbildung 4.16 zeigt den klinischen Verlauf beider Gruppen. Bei den Tieren, die mit nativer rhG6PI immunisiert wurden, handelt es sich um die gleiche Gruppe, die schon in Kapitel 4.2.6 beschrieben wurde. Die Tiere entwickelten nach 9 Tagen eine Arthritis, die ihren maximalen Arthritisgrad an Tag 12 erreichte und dann langsam abnahm.


[Seite 64↓]

Abb. 4.16: Arthritisinduktion mit denaturierter rhG6PI.DBA/1 Mäuse wurden mit nativer rhG6PI (Quadrat) oder denaturierter rhG6PI (Dreieck) immunisiert und über 30 Tage auf die Entwicklung einer Arthritis beobachtet. 9/9 DBA/1 Mäuse immunisiert mit nativer rhG6PI bzw. 9/10 DBA/1 Mäuse immunisiert mit denaturierter rhG6PI entwickelten eine Arthritis (A). Der klinische Verlauf beider Gruppen zeigte keine signifikanten Unterschiede auf (P > 0,05)(B).

Auch die Tiere, die mit gekochter denaturierter rhG6PI immunisiert wurden, entwickelten nach 9 Tagen erste klinische Anzeichen einer Arthritis. Die Arthritis erreichte ihr klinisches Maximum an Tag 14 mit einem mittleren Arthritisgrad von 6,5 ± 0,9. Anschließend nahm die Arthritis wie auch in den Tieren, die mit nativer rhG6PI immunisiert wurden langsam ab. An Tag 20 wurde nur noch ein Arthritisgrad von 4,2 ± 1,3 gemessen und an Tag 30, dem Ende des Beobachtungszeitraumes, ein Arthritisgrad von 1,6 ± 0,6. Die Inzidenz bei den Tieren, die mit denaturierter rhG6PI immunisiert wurden, betrug 90%, da 9/10 Tieren eine Arthritis entwickelten, und war vergleichbar mit den Tieren, die mit nativer G6PI immunisiert wurden. Die klinischen Verläufe zeigten keine signifikanten Unterschiede auf. Eine statistische Analyse mit Hilfe des Mann-Whitney Tests lieferte zu jedem Zeitpunkt einen P-Wert > 0,05.

4.2.8 Arthritisinduktion in DBA/1 Mäusen mit Kaninchen Glukose-6-phosphat Isomerase

Die Immunisierung mit rekombinanter humaner oder muriner G6PI induzierte eine Arthritis in DBA/1 Mäusen. Diese Proteine wurden in einem prokaryotischen Expressionssystem im E.coli Stamm BL21(DE3)produziert und über eine 6 Histidinmarkierung am N-Terminus über eine Nickelsäule aufgereinigt. Um auszuschließen, dass die beobachtete Arthritis in DBA/1 Mäusen durch mikrobielle Verunreinigungen bzw. die Histidinmarkierung am N-Terminus der Proteine induziert wurde, wurden DBA/1 Mäuse mit kommerziell erhältlicher G6PI aus dem Muskel von Kaninchen immunisiert. Die Kaninchen G6PI enthält keine mikro[Seite 65↓]biellen Rückstände und auch keine Histidinmarkierung am N-Terminus. Trotzdem ist das Protein nicht rein und enthält Kontaminationen in Form anderer Proteine aus dem Muskel (siehe 4.1.3).Die Homologie zwischen humaner und Kaninchen G6PI beträgt 92%. Abb. 4.17 zeigt den klinischen Verlauf der DBA/1 Tiere, die mit Kaninchen G6PI immunisiert wurden.

Abb. 4.17: Arthritisinduktion mit Kaninchen G6PI. 5 DBA/1 Mäuse wurden mit Kaninchen G6PI immunisiert und über einen Zeitraum von 32 Tagen auf klinische Zeichen einer Arthritis beobachtet. Alle Tiere entwickelten nach 10 Tagen eine Arthritis (A), die an Tag 15 ihr Maximum erreichte und bis Tag 24 auf diesem Niveau blieb (B). An Tag 30 waren kaum noch klinische Zeichen einer Arthritis zu beobachten.

Alle fünf Tiere entwickelten nach 10 Tagen eine Arthritis, die an Tag 15 ihren maximalen mittleren Arthritisgrad von 4,6 ± 1,4 erreichte. Anschließend blieb der mittlere Arthritisgrad ungefähr gleich und hatte an Tag 22 noch eine Wert von 4,2 ± 1,6. Erst nach Tag 26 fiel der mittlere Arthritisgrad rapide ab und erreichte an Tag 32 einen Wert von 0,6 ± 0,4.

4.2.9 Enzymaktivität der Glukose-6-phosphat Isomerase im Serum unterschiedlicher Mausstämme

Der DBA/1 Stamm war der einzige Stamm der nach Immunisierung mit rhG6PI in der Mehrzahl der Mäuse eine Arthritis entwickelte. Alle anderen Stämme waren nicht-suszeptibel. Nun sollte untersucht werden, ob sich die Konzentration der G6PI im Serum der suszeptiblen DBA/1 Mäuse und den nicht-suzeptiblen Stämmen BALB/c und C57BL/6 Mäusen unterscheidet. Die enzymatische Aktivität der G6PI wurde über die Umsetzung von NADP bei 340nm photometrisch bestimmt. Mit diesem Verfahren wurde auch die enzymatische Aktivität der rekombinanten hergestellten G6PI bestimmt (Daten nicht gezeigt). Die geringste Enzymaktivität und damit auch die geringste Konzentration an G6PI im Serum wurde bei BALB/c Mäusen ermittelt (Abb. 4.18). Hier betrug die Aktivität der G6PI 0,47 ± 0,09 U/ml. Die Aktivität der G6PI im Serum von DBA/1 Mäusen betrug 0,59 ± 0,16 U/ml. Die höchste Enzymaktivität des Serums konnte dagegen bei den C57BL/6 Mäusen gemessen werden.


[Seite 66↓]

Abb. 4.18: Aktivität der Glukose-6-phosphat Isomerase im Serum. Serum aus je 3 naiven DBA/1, BALB/c und C57BL/6 Mäusen wurde gewonnen. Die Aktivität der G6PI im Serum wurde enzymatisch bestimmt. Je Stamm wurden 3 Tiere untersucht.

Im Serum dieser Mäuse konnte eine Enzymaktivität der G6PI von 0,69 ± 0,09 U/ml gemessen werden. Die Ergebnisse zeigen, dass die Enzymaktivitäten der drei untersuchten Stämme alle im gleichen Bereich zwischen 0,47 und 0,69 U/ml liegen.

4.3 Die Rolle der B-Zellen, der Antikörper und des Komplements in der G6PI-induzierten Arthritis

4.3.1 Die humorale Immunantwort gegen Glukose-6-phosphat Isomerase in DBA/1 Mäusen und nicht suszeptiblen Stämmen

Hier sollten die Antikörperantworten gegen murines und humanes G6PI in dem suszeptiblen DBA/1 Mausstamm und den nicht-suszeptiblen Mausstämmen nach rhG6PI Immunisierung gemessen werden. Dadurch sollte untersucht werden, ob die Suszeptibilität mit der unterschiedlichen Fähigkeit zur Produktion von anti-G6PI Antikörpern in den untersuchten Mausstämmen zusammenhängt. Zu diesem Zweck wurden Mäuse unterschiedlicher Stämme mit rhG6PI immunisiert und zu verschiedenen Zeitpunkten Serum gewonnen. Das gewonnene Serum wurde im ELISA auf die Anwesenheit von anti-G6PI Antikörpern getestet. Dazu wurde rhG6PI oder rmG6PI an ELISA Platten gebunden, mit seriellen Verdünnungen von Seren immunisierter Mäuse inkubiert und die Bindung von IgG detektiert. Abb. 4.19 zeigt die Antikörpertiter von DBA/1 Mäusen gegen rhG6PI oder rmG6PI zu unterschiedlichen Zeitpunkten nach Immunisierung mit rhG6PI. An Tag 3 nach Immunisierung mit rhG6PI waren noch keine Antikörper gegen rhG6PI oder gegen rmG6PI messbar.


[Seite 67↓]

Abb. 4.19: IgG-Antwort gegen rhG6PI oder rmG6PI in DBA/1 Mäusen nach Immunisierung mit rhG6PI. DBA/1 Mäuse wurden mit rhG6PI immunisiert. Zu den angegebenen Zeitpunkten wurden von je drei Tieren Serum gewonnen, seriell verdünnt und die IgG-Antwort gegen rmG6PI (gefüllte Balken) und rhG6PI (offene Balken) im ELISA gemessen. Die höchste Serumverdünnung bei der anti-G6PI Antikörper noch detektierbar waren, wurden als Mittel ± SEM dargestellt.

Erste erhöhte Konzentrationen von anti-G6PI IgG Antikörpern im Serum wurden an Tag 6 gemessen. Dabei konnte schon ein hoher IgG Titer gegen rhG6PI gemessen werden, der bei 1:2.133 lag, während der IgG Titer gegen rmG6PI noch deutlich niedriger bei 1:134 lag. Von Tag 9 an konnten sowohl gegen rhG6PI als auch gegen rmG6PI hohe Titer gemessen werden, die über den gesamten Beobachtungszeitraum hoch blieben. Die Titer schwankten dabei gegen rhG6PI von 1:2.667 an Tag 26 bis 1:6.400 an Tag 30. Gegen rmG6PI variierten die Titer zwischen 1:534 an Tag 26 und 1:2.800 an Tag 30. Insgesamt waren die IgG-Titer in DBA/1 Mäusen nach Immunisierung mit rhG6PI gegen rhG6PI zu jedem untersuchtem Zeitpunkt höher als gegen rmG6PI. In gleicher Weise wurden auch die nicht-suszeptiblen Stämme auf die Produktion von anti-G6PI Antikörpern untersucht. In Abb. 4.20A sind die Antikörpertiter nicht-suzeptibler Stämme nach Immunisierung mit rhG6PI gegen humanes G6PI dargestellt. Wie bei den DBA/1 Mäusen war an Tag 3 noch kein erhöhter Antikörpertiter gegen rhG6PI messbar. Erst an Tag 6 zeigten der AKR und der B10.Q Stamm erhöhte Titer von 1:50. Alle anderen getesteten Stämme (SWR, C57BL/6, BALB/c und B10.A) entwickeltem zu diesem Zeitpunkt noch keine messbaren Titer gegen rhG6PI. Beginnend von Tag 10 konnte dann bei allen getesteten Stämmen ein erhöhter Titer gemessen werden, wobei die AKR Tiere mit 1:850 den niedrigsten und die C57BL/6 Tiere mit 1:16.000 den höchsten Titer aufwiesen. An den Tagen 20 und 30 nahmen die Titer gegen rhG6PI bei allen untersuchten Stämmen zu. An [Seite 68↓]Tag 20 entwickelten die B10.A Mäuse mit 1:6.400 den niedrigsten und die C57BL/6 Tiere mit 1:54.400 den höchsten Titer. An Tag 30 hatten die B10.Q mit 1:16.000 den niedrigsten und die AKR mit 1:256.000 den höchsten Titer. Außerdem wurden auch die Antikörpertiter gegen rmG6PI in nicht-suzeptiblen Mausstämmen nach rhG6PI Immunisierung untersucht. Erste Titer gegen rmG6PI entwickelten sich bei allen Stämmen von Tag 10 an (Abb. 4.20 B). An Tag 10 produzierten die BALB/c Mäuse mit 1:50 den niedrigsten und die C57BL/6 Tiere mit 1:3.250 den höchsten Titer. Wie beim rhG6PI nahmen die Titer an Tag 20 und Tag 30 weiter zu.

Abb. 4.20: Auch die nicht-suszeptiblen Stämme entwickeln Antikörper gegen G6PI. Mäuse nicht-suszeptibler Mausstämme für die G6PI-induzierte Arthritis wurden mit rhG6PI immunisiert. Zu bestimmten Zeitpunkten wurde von je zwei Tieren Serum gewonnen, seriell verdünnt und die IgG-Antwort gegen rhG6PI (Abbildung A) und rmG6PI (Abbildung B) im ELISA gemessen. Die höchste Serumverdünnung bei der anti-G6PI Antikörper noch detektierbar waren, wurden als Mittel ± SEM dargestellt.

An Tag 20 hatten die AKR mit 1:1.600 den niedrigsten und die C57BL/6 mit 1:64.000 den höchsten Titer. An Tag 30 konnten bei den BALB/c Mäusen mit einem Titer von 1:4.000 die geringste und wieder bei den C57BL/6 mit 1:640.000 die höchste Konzentration an anti-rmG6PI Antikörpern gemessen werden. Alle Stämme entwickelten anti-G6PI IgG Titer sowohl gegen rhG6PI als auch gegen rmG6PI nach Immunisierung mit rhG6PI, und die Konzentrationen nahmen im Lauf der Zeit zu bzw. blieben konstant hoch. Die Titer gegen rhG6PI waren dabei immer höher als gegen rmG6PI. Die Antikörperantwort gegen rhG6PI und gegen rmG6PI trat in den nicht-suszeptiblen Stämmen im Gegensatz zu den DBA/1 Mäusen etwas verzögert ein. Erste Titer gegen rmG6PI wurden erst an Tag 10 gemessen. An Tag 6 entwickelten erst 2 von 6 Stämmen Antikörper gegen rhG6PI.


[Seite 69↓]

4.3.2  Die unterschiedlichen Isotypen der anti-G6PI Antikörper nach Arthritisinduktion in DBA/1 Mäusen

Im K/BxN- und im CIA-Modell ist der Transfer der Arthritis durch Transfer von IgG1 Antikörpern gegen G6PI im K/BxN-Modell oder IgG2 Antikörper gegen Kollagen II im CIA-Modell möglich. Im Folgenden wurde untersucht welche Isotypen die gegen G6PI gebildeten Antikörper haben. Dazu wurden DBA/1 Mäuse mit rhG6PI immunisiert und zu unterschiedlichen Zeitpunkten Serum gewonnen. Dieses Serum wurde seriell verdünnt und in einem isotypspezifischen ELISA auf die Anwesenheit G6PI spezifischer Antikörper hin untersucht. Der erste untersuchte Zeitpunkt war Tag 6, da zuvor noch keine Antikörper gegen rhG6PI messbar waren (siehe voriges Kapitel).

Abb. 4.21: Antikörperantwort unterschiedlicher Ig-Isotypen gegen rhG6PI nach Immunisierung mit rhG6PI in DBA/1 Mäusen. DBA/1 Mäuse wurden mit rhG6PI immunisiert. Zu unterschiedlichen Zeitpunkten wurde von 3 Mäusen Serum gewonnen. Das Serum wurde seriell verdünnt und im ELISA auf die Anwesenheit isotypspezifischer anti-rhG6PI Antikörper getestet. Die Antikörpertiter der unterschiedlichen Isotypen zu jedem Zeitpunkt wurden als Mittel ± SEM dargestellt.

An Tag 6 wurde ein erhöhter Antikörpertiter nur gegen IgM und IgG1 gemessen. Der Titer des anti-G6PI-IgM lag bei 1:100 und der anti-G6PI-IgG1 Titer bei 1:67. Von Tag 9 an wurden anti-G6PI Antikörper aller untersuchter Isotypen detektiert. Der Titer der IgM Antikörper lag dabei bei 1:200. Der höchste Titer konnte bei IgG1 gemessen werden und lag bei 1:12.800. Die Antikörper der Subklassen IgG2a und IgG2b entwickelten jeweils einen Titer von 1:2.300. Auch IgG3 wurde schon detektiert und entwickelte einen Titer von 1:567. Dieses Höhe der Titer blieb für die untersuchten Isotypen auch an den Tagen 12 und 15 in diesem Bereich. Erst von Tag 18 an nahmen die Antikörpertiter der untersuchten Isotypen zu. Die höchsten Titer wurden zwischen Tag 26 und 30 beobachtet. IgM erreichte seinen höchsten anti-G6PI Titer an Tag 30 mit einem Titer von 1:4.300. Das Gleiche galt für die Titer der IgG2a, IgG2b und IgG3 Subklassen. Die anti-G6PI Antikörper der Subklasse IgG2a entwickelten an Tag 30 einen Titer von 1:19.200, der Subklasse IgG2b einen Titer von 1:25.600 und der Subklasse IgG3 einen [Seite 70↓]Titer von 1:4.800. Die anti-G6PI Antikörper der Subklasse IgG1 produzierten die höchsten Antikörpertiter an Tag 26 mit einem Titer von 1:179.200. Von Tag 6 an wurden immer anti-G6PI Antikörper der Isotypen IgM und IgG1 gemessen. Ab Tag 9 entwickelten die IgG1 Antikörper zu jedem Zeitpunkt die höchsten anti-G6PI Titer. IgG1 Antikörper waren der vorherrschende Isotyp nach Immunisierung mit rhG6PI. Danach folgten die Antikörper der IgG2a und IgG2b Subklasse, die von Tag 9 an immer ungefähr gleiche Titer produzierten. Die geringste Konzentration an anti-G6PI Antikörpern nach Immunisierung mit rhG6PI wurde von der Subklasse IgG3 gemessen.

4.3.3 Bildung von Rheumafaktoren, dsDNS-Antikörpern sowie anti-Kollagen Antikörpern nach Arthritisinduktion

Ca. 60-80 % der Patienten mit rheumatoider Arthritis produzieren sogenannte Rheumafaktoren. Bei anderen entzündlichen Autoimmunerkrankungen z.B. dem systemischen Lupus Erythematodis (SLE) aber auch bei Patienten mit RA findet man IgG-Antikörper gegen doppelsträngige DNS (anti-dsDNS). Außerdem werden bei entzündlichen Immunreaktionen in den Gelenken häufig auch Antikörper gegen das in den Gelenken vorkommende Kollagen II gebildet.

Daher sollte untersucht werden, ob DBA/1 Mäuse nach Arthritisinduktion durch rhG6PI Rheumafaktoren, Antikörper gegen doppelsträngige DNS bzw. gegen Kollagen II entwickeln. Serum aus 35 DBA/1 Mäusen wurde 14-18 Tage nach Immunisierung mit rhG6PI gewonnen und gemischt. Im ELISA wurde dieses Serum seriell verdünnt und auf die Anwesenheit von gegen IgG gerichtete IgM Antikörper, sogenannte Rheumafaktoren, getestet (Abb. 4.22 A). Zur Kontrolle wurde Serum einer MRL/lpr Maus verwendet, die spontan Rheumafaktoren und Antikörper gegen doppelsträngige DNS bilden. Bis zu einer Serumverdünnung von 1:800 des Serum der MRL/lpr Maus wurden erhöhte Antikörpertiter gegen IgG gemessen. Dagegen zeigte das gemischte Serum der DBA/1 Mäuse keine erhöhte Konzentration von IgM Anti körpern, die gegen IgG gerichtet waren. Selbst bei einer Verdünnung von 1:100 lag die Absorption bei 450nm immer noch auf dem Niveau des Hintergrundes. Ein ähnliches Bild zeigte sich bei den gegen dsDNS gerichteten Antikörpern (Abb. 4.22 B). Das Serum der MRL/lpr Maus zeigte schon bei einer Verdünnung von 1:6.400 eine erhöhte Konzentration von anti-dsDNS Antikörpern an. Da 1:6.400 die höchste getestete Verdünnung war, lag der Titer möglicherweise noch höher. Das Serum der DBA/1 Mäuse dagegen zeigte bei einer Verdünnung von 1:100 eine dreimal so große Absorption wie die Absorption des Hintergrundes.


[Seite 71↓]

Abb. 4.22: Die Bildung von anti-dsDNS- und anti-Kollagen II Antikörpern sowie Rheumafaktoren nach Arthritisinduktion.DBA/1 Mäuse wurden mit rhG6PI immunisiert. Zwischen den Tagen 14-18 nach Immunisierung wurde Serum von 35 Mäusen mit Arthritis gewonnen und gemischt. Außerdem wurde Serum aus einer 12 Wochen alten MRL/lpr Maus gewonnen. Im ELISA wurden die Seren seriell verdünnt und auf die Anwesenheit von Rheumafaktoren (anti-IgG-Maus-IgM) (A) und Antikörper gegen doppelsträngige DNS (anti-dsDNS-IgG) untersucht (B). Zusätzlich wurde Serum von einer mit PBS/CFA bzw. mit murinem Kollagen II/CFA (CII) immunisierten DBA/1 Maus gewonnen und im ELISA zusammen mit dem gemischtem Serum der Mäuse nach G6PI Immunisierung auf die Anwesenheit von anti-Kollagen-II Antikörpern untersucht (C).

Damit betrug der Titer 1:100. DBA/1 Mäuse entwickelten geringe Mengen an IgG Antikörpern, die gegen dsDNS gerichtet waren. Das gemischte Serum der kranken Tiere und das Serum der mit Kollagen II immunisierten DBA/1 Maus wurde auf die Anwesenheit von anti-Kollagen II Antikörpern getestet (Abb. 4.22 C). Um sicherzustellen, dass nicht schon allein die Immunisierung mit CFA zu erhöhten Titern gegen Kollagen II führte, wurde auch Serum einer PBS/CFA immunisierten DBA/1 Maus im ELISA untersucht. Sowohl das Serum der kranken DBA/1 Tiere, als auch das Serum der PBS/CFA immunisierten Maus zeigten bei einer Verdünnung von 1:100 keine erhöhte Antwort. Dagegen wurde in der mit murinem Kollagen II in CFA immunisierten Maus schon bei einer Verdünnung von 1:900 ein deutlich erhöhter Titer von Kollagen II Antikörpern festgestellt.DBA/1 Mäuse entwickelten 18 Tage [Seite 72↓]nach Immunisierung mit rhG6PI keine Rheumafaktoren und keine Antikörper gegen Kollagen II. Antikörper gegen dsDNS konnten nur in sehr geringen Konzentrationen detektiert werden.

4.3.4 Transfer der Arthritis durch Transfer von Antikörpern in DBA/1 Mäusen

Im K/BxN-Modell ist es möglich, die Arthritis durch Transfer von geringen Mengen Serum arthritischer Mäuse in fast jeden Empfängerstamm zu transferieren. Die Rolle der gegen rhG6PI gebildeten Antikörper an der Pathogenese der G6PI-induzierten Arthritis in DBA/1 Mäusen nach Immunisierung mit rhG6PI sollte untersucht werden. Mit Hilfe aufgereinigter Antikörper aus arthritischen DBA/1 Mäusen sollte versucht werden, die Krankheit zu transferieren. Zwischen Tag 14 und 18 nach Immunisierung wurde von Mäusen mit Arthritis Serum gewonnen. Die Antikörper in diesem Serum wurden über eine Protein G Säule aufgereinigt. Die Ig-Fraktion wurde in PBS verdünnt und unterschiedliche Mengen an Tag 0 und Tag 2 in DBA/1 Empfängermäuse i.p. transferiert. Der Transfer erfolgte entweder in naive DBA/1 Mäuse oder in DBA/1 Mäuse, die 7 Tage zuvor mit PBS/CFA immunisiert wurden. Einige der naiven DBA/1 Mäuse erhielten 2 Tage nach dem ersten Transfer 50µg LPS. Keines der je 2 naiven DBA/1 Tiere entwickelte nach Transfer von entweder 2 x 1mg oder sogar 2 x 5 mg aufgereinigtem IgG eine Arthritis (Tab. 4.3).

Tab. 4.3: Transfer der Arthritis durch Transfer aufgereinigter Antikörper in DBA/1 Mäuse. Serum von DBA/1 Mäusen mit Arthritis 14-18 Tage nach Immunisierung mit rhG6PI wurde gewonnen und die Ig Fraktion über eine Protein G Säule aufgereinigt. Unterschiedliche Mengen der Ig-Fraktion wurden an Tag 0 und Tag 2 naiven DBA/1 Mäusen oder DBA/1 Mäusen, die 7 Tage zuvor mit PBS/CFA immunisiert wurden, i.p. in PBS verabreicht. Einige der naiven DBA/1 Mäuse erhielten 2 Tage nach der ersten Antikörpergabe zusätzlich 50µg LPS in PBS i.p. Über eine Zeitraum von 30 Tagen wurden die Tiere auf klinische Zeichen einer Arthritis beobachtet.

Transfer von aufgereinigtem IgG in DBA/1 Mäuse

Menge

Zusätzliche Behandlung

Arthritisinduktion

2 x 1 mg

X

0/2

2 x 5 mg

X

0/2

2 x 2 mg

Transfer nach PBS/CFA Immunisierung an Tag -7

0/2

2 x 5 mg

Transfer nach PBS/CFA Immunisierung an Tag -7

0/2

2 x 1 mg

50µg LPS an Tag 2

0/2

2 x 2 mg

50µg LPS an Tag 2

0/2

2 x 5 mg

50µg LPS an Tag 2

0/1


[Seite 73↓]

Auch nach Aktivierung durch PBS/CFA Immunisierung 7 Tage vor dem Transfer von 2 x 2mg oder 2 x 5mg zeigten die 2 Tiere in jeder Gruppe keine klinischen Zeichen einer Arthritis. Im K/BxN-Modell konnte die Effizienz des Antikörpertransfers gesteigert werden, wenn zusätzlich LPS gespritzt wurde. Aus diesem Grund wurden in der dritten Gruppe den Tieren 2 Tage nach dem ersten Transfer der Antikörper zusätzlich auch 50µg LPS injiziert. Je 2 Tiere dieser Gruppe erhielten 2 x 1mg und 2 x 2mg und ein Tier 2x 5mg. Auch in dieser Gruppe entwickelte keines der Tiere klinische Zeichen einer Arthritis. Da eine leichte inflammatorische Aktivität in den Gelenken sich nicht klinisch manifestieren musste, wurden die Tiere dieser Gruppe auch histologisch untersucht. In Abb. 4.23 werden Gelenkschnitte von DBA/1 Mäusen dargestellt, die 2x 5mg aufgereinigtes Ig und zusätzlich 2 Tage später auch 50µg LPS injiziert bekamen. Die Gelenkschnitte zeigten jedoch keine Infiltration inflammatorischer Zellen.

Abb. 4.23: Histologische Untersuchung einer hinteren Pfote nach Ig-Transfer und LPS-Aktivierung. Einer DBA/1 Maus wurde 2x5mg einer aus dem Serum von arthritischen DBA/1 Mäusen aufgereinigten Ig-Fraktion i.p. injiziert. Zusätzlich wurde dem Tier 50µg LPS i.p. an Tag 2 injiziert. Gezeigt sind HE-Schnitte (100x Vergrößerung) 24 Tage nach Ig-Transfer vom Fußknöchel (A) und von einem tarsalem Gelenk (B).

4.3.5 Die Rolle der Fcγ-Rezeptoren bei der Arthritisinduktion mit Glukose-6-phosphat Isomerase

Fcγ-Rezeptoren stellen eine wichtige Verbindung zwischen Antikörper-Antigen Komplexen und den zellulären Effektormechanismen der Zellen des Immunsystems dar. In der G6PI-induzierten Arthritis sollte untersucht werden, welche Rolle die Fcγ-Rezeptoren bei der Pathogenese der Arthritis spielen. Indirekt sollte damit auch die Rolle der produzierten Antikörper und deren Fähigkeit durch Vernetzen von Fcγ-Rezeptoren, die Pathogenese der Arthritis zu beeinflussen, untersucht werden.


[Seite 74↓]

Abb. 4.24: Die Rolle der Fcγ-Rezeptoren in der G6PI-induzierten Arthritis. Wildtyp DBA/1 Mäuse, DBA/1 FcγRIIB-/- Mäuse und DBA/1 Mäuse, die defizient für die gemeinsame γ-Kette waren wurden mir rhG6PI immunisiert und der klinische Verlauf der Arthritis über einen Zeitraum von 54 Tagen verfolgt. Gezeigt wird der mittlere klinische Index ± SEM der Tiere, die eine Arthritis entwickelten. Die Inzidenz der Arthritis lag bei den Wildtyp DBA/1 Mäusen bei 10/11 Tieren, bei den FcγRIIB-/- Mäusen bei 16/16 und 8/24 bei den DBA/1 Mäusen, die defizient für die gemeinsame γ-Kette waren.

Die Rolle des inhibierenden Fcγ-Rezeptors FcγRII wurde mit Hilfe von FcγRIIB-/- Mäusen auf DBA/1 Hintergrund untersucht. Die Rolle der aktivierenden Fcγ-Rezeptoren FcγRI und FcγRIII wurde mit Hilfe eines Mausstammes auf DBA/1 Hintergrund untersucht, der defizient für die gemeinsame γ-Kette war. 16 FcγRIIB-/- auf DBA/1 Hintergrund und 24 Mäuse auf DBA/1 Hintergrund, die defizient für die gemeinsame γ-Kette sind, wurden mit rhG6PI immunisiert. Zur Kontrolle wurde in 11 Wildtyp DBA/1 Tieren eine Arthritis induziert und der klinische Verlauf der Arthritisinduktion in den drei Gruppen über 30 Tage bei den Wildtypmäusen oder 54 Tage bei den FcγRIIB-/- oder gemeinsame γ-Kette defizienten Mäuse auf DBA/1 Hintergrund beobachtet (Abb. 4.24). 10 von 11 Wildtyp DBA/1 Mäusen entwickelten an Tag 9 nach Immunisierung erste Anzeichen einer Arthritis. Der klinische Index nahm bis Tag 15 zu und erreichte dort sein Maximum bei 5,8 ± 0,7. Anschließend nahm der Schweregrad der Arthritis im klinischen Verlauf wieder langsam ab und erreichte an Tag 30 noch einen relativ hohen mittleren Schweregrad der Arthritis von 3,7 ± 1,2. In der Grafik wurden in allen drei Gruppen nur die Tiere dargestellt, die zu irgendeinem Zeitpunkt klinische Zeichen einer Arthritis zeigten. Nur 8/24 (33%) der Mäuse, die defizient für die gemeinsame γ-Kette waren, entwickelten zwischen den Tagen 9 und 13 schwache klinische Zeichen einer Arthritis. Erst an Tag 15 wurde ein mittlerer Arthritisgrad von 1,6 ± 0,3 gemessen, der bis Tag 29 [Seite 75↓]relativ konstant blieb und zwischen 1,2 ± 0,5 an Tag 18 und 1,7 ± 0,4 an Tag 21 schwankte. Danach nahm der Schweregrad der Arthritis kontinuierlich bis auf 0,1 ± 0,1 an Tag 54 ab.

Abb. 4.25: HE-färbung eines Gelenkschnit-tes (100x Vergrößerung) an Tag 21 nach Arthritisinduktion in einer DBA/1 Fc γ RIIB -/- Maus. DBA/1 FcγRIIB-/- Mäuse wurden mit rhG6PI immunisiert und an Tag 21 histologisch untersucht. Gezeigt wurde eine schwere Synovitis (Pfeil), Periostitis (*), Tenosynovitis (Pfeilkopf) und Periarthritis (Ο) des Sprunggelenks an einer hinteren Pfote der Maus. Der eingefügte Schnitt zeigt einen Ausschnitt (200x Vergrößerung) aus dem Überblicksschnitt. Hier konnten deutlich multinukleäre Osteoklasten (Ο), eine gerissene Sehne mit nekrotischem Gewebe (Pfeil), sowie dichte inflammatorische Infiltrate beobachtet werden (Pfeilköpfe). Außerdem kam es zur Pannusformation (*), welcher aus Lymphozyten, Fibroblasten, Mastzellen, Makrophagen und neutrophilen Granulozyten bestand und zur Zerstörung des Knochen führte.

Alle DBA/1 FcγRIIB-/- Tiere entwickelten 9 Tage nach Immunisierung eine Arthritis deren Schweregrad bis Tag 15 schnell zunahm und dort und an Tag 18 einen maximalen mittleren Grad von 7,3 ± 1,2 erreichte. Dieser Wert lag deutlich über den gemessenen 5,8 ± 0,7 der Wildtyp DBA/1 Mäuse an Tag 15. Anschließend nahm die Arthritis langsam ab. An Tag 54 wurde noch ein mittlerer Schweregrad von 3,6 ± 0,9 gemessen. Die DBA/1 FcγRIIB-/- Mäuse entwickelten eine Arthritis mit schwererem Verlauf und höherer Inzidenz als die Kontrollgruppe der Wildtyp DBA/1 Mäuse. Im Gegensatz dazu entwickelten die DBA/1 Mäuse, die defizient für die gemeinsame γ-Kette waren, eine Arthritis mit geringer Inzidenz und mildem klinischen Verlauf. Auch histologisch konnte der schwerste klinische Verlauf der DBA/1 FcγRIIB‑/‑ Mäuse beobachtet werden (Abb. 4.25). Der HE-Schnitt zeigt eine 100x Vergrößerung des Sprunggelenks einer hinteren Pfote dieser Tiere. Deutlich konnten massiven Infiltrationen inflammatorischer Zellen beobachtet werden, die stärker waren als in den Wildtyp DBA/1 Mäusen (Vergleiche Kap. 4.2.3). Die Infiltrationen in die synoviale Deckzellschicht führte zu einer Synovitis stärksten Grades mit starker Verdickung der Deckzellschicht. Die Inflammation betraf aber auch das umliegende Gewebe, insbesondere die Sehnen und Knochen. So war deutlich eine Infiltration der Sehne zu beobachten, die sogar zur Ruptur der Sehne führte (Pfeilköpfe). In der Vergrößerung dieses Ausschnittes (200x) konnte nekroti[Seite 76↓]sches Gewebe um die gerissene Sehne herum beobachet werden (Pfeil und Pfeilköpfe in der Vergrößerung). Daneben war eine Periostitis (*) der umliegenden Knochen und eine Periarthritis (O) zu beobachten. Die Vergrößerung des Ausschnittes zeigte auch die Formierung eines Pannus (*). Dieser Pannus bestand aus Fibroblasten, Lymphozyten, Mastzellen, Makrophagen und neutrophilen Granulozyten und führte zur vollständigen Zerstörung des Knochens.

Abb. 4.26: Antikörpertiter gegen G6PI nach Arthritisinduktion in DBA/1 Fc γ RIIB -/- und Fc γ R -/- Mäusen. Je fünf DBA/1 FcγRIIB-/- und FcRγ-/- Mäuse wurden mit rhG6PI immunisiert. An Tag 21 wurde Serum gewonnen und im ELISA auf die Anwesenheit von Antikörpern, die gegen rhG6PI und rmG6PI gerichtet waren, untersucht. Die höchste Serumverdünnung bei der anti-G6PI Antikörper noch detektierbar waren, wurde als Mittel ± SEM dargestellt.

Zusätzlich sollte die Antikörperentwicklung gegen G6PI im G6PI-induzierten Modell in den FcγRIIB-/- DBA/1 Mäusen und in den gemeinsame γ-Kette defizienten DBA/1 Mäusen untersucht werden. An Tag 21 nach Immunisierung wurde Serum aus den Tieren gewonnen und im ELISA auf die Anwesenheit von anti-G6PI Antikörpern untersucht. Die DBA/1 Tiere, die defizient für die gemeinsame γ-Kette waren, entwickelten einen Antikörpertiter von 1:348.160 gegen rhG6PI und von 1:40.960 gegen rmG6PI. Die DBA/1 FcγRII-/- Mäuse entwickelten einen Antikörpertiter von 1:409.600 gegen rhG6PI und von 1:25.600 gegen rmG6PI. Die Antikörpertiter lagen bei beiden Stämmen sowohl gegen humane G6PI als auch gegen murine G6PI in der gleichen Größenordnung. In beiden untersuchten Stämmen wurden weniger Antikörper gegen murine G6PI gebildet als gegen humane G6PI. Somit hatte es auf die Entwicklung von Antikörpern gegen G6PI keinen Einfluss, ob DBA/1 FcγRII-/- oder DBA/1 Mäuse, die defizient für die gemeinsame γ-Kette waren, mit rhG6PI immunisiert wurden.


[Seite 77↓]

4.3.6  Die Rolle des Komplementfaktors C5 bei der Arthritisinduktion mit Glukose-6-phosphat Isomerase

Die Antikörperbindung an Antigene führt nicht nur zur Aktivierung akzessorischer Effektorzellen, die über Fc-Rezeptoren verfügen. Antikörper sind auch an der Schnittstelle zwischen adaptiver und angeborener Immunität bei der Aktivierung des klassischen Weges der Komplementkaskade beteiligt. Hier sollte untersucht werden, ob bei der G6PI-induzierten Arthritis in DBA/1 Mäusen das Komplementsystem für die Pathogenese wichtig ist. Durch Blockierung oder Depletion von C5, der zentralen Komponente der Komplementkaskade, kann die Komplementkaskade inhibiert werden. Hier wurde die Rolle des Komplements durch Depletion von C5 mit dem C5-depletierenden Antikörper BB5.1 untersucht. DBA/1 Mäuse wurden mit rhG6PI immunisiert. An den Tagen 6, 9 und 12 nach Immunisierung wurden die Tiere jeweils mit 750µg des Antikörpers BB5.1 durch i.p. Injektion behandelt. Der klinische Verlauf und die Inzidenz wurde über 30 Tage beobachtet (Abb. 4.27).

Abb. 4.27: Die Rolle des C5 Komplementfaktors in der G6PI-induzierten Arthritis. DBA/1 Mäuse wurden mit rhG6PI immunisiert. An Tag 6, 9 und 12 wurden 10 Tiere mit dem C5 depletierenden Antikörper BB5.1 durch i.p. Injektion behandelt (Quadrate). 5 Tiere blieben unbehandelt (Dreiecke). Die Tiere wurden über einen Zeitraum von 30 Tagen hinsichtlich der Inzidenz mit der die Arthritis auftrat (A) beobachtet. Die Tiere, die eine Arthritis entwickelten, gingen in den klinischen Verlauf ein (B). Gezeigt wurde der mittlere klinische Index ± SEM.

Die Kontrolltiere entwickelten 9 Tage nach Immunisierung eine Arthritis. 80% aller unbehandelten DBA/1 Tiere zeigten zu diesem Zeitpunkt schon klinische Zeichen einer Arthritis (Abb. 4.27 A). Zwischen Tag 10 und Tag 17 litten alle Tiere unter einer Arthritis. Von Tag 19 an nahm die Inzidenz von 80% bis auf 20% an Tag 26 ab. Bei den behandelten Tiere waren an Tag 10 erst 11 % der Tiere krank. Auch danach entwickelte sich die Arthritis langsamer und mit geringerer Inzidenz als bei der Kontrollgruppe. Die Inzidenz stieg bis zum Tag 17 auf 66%, nahm dann zwei Tage später wieder auf 44% ab und fiel dann bis Tag 26 auf 11% ab. Von Tag 28 an zeigte keines der Tiere mehr klinische Zeichen einer Arthritis. Neben der [Seite 78↓]unterschiedlichen Inzidenz war auch der klinische Verlauf der erkrankten Tiere unterschiedlich (Abb. 4.27 B). Die Kontrollgruppe zeigte einen normalen Verlauf der Erkrankung und erreichte an Tag 12 einen maximalen mittleren Arthritisgrad von 5,4 ± 0,7. Anschließend nahm der mittlere Arthritisgrad beginnend von Tag 17 wieder kontinuierlich ab, bis an Tag 30 nur noch ein mittlerer Arthritisgrad von 0,6 ± 0,6 gemessen wurde. Bei den behandelten Tieren wurde erst an Tag 12 ein mittlerer Arthritisgrad von 2,2 ± 1,3 gemessen. Zwischen dem Tag 12 und 21 schwankte der mittlere Arthritisgrad zwischen 1,7 ± 0,9 an Tag 14 und 2,8 ± 0,9 an Tag 21. Anschließend nahm der mittlere Arthritisgrad kontinuierlich ab. An Tag 30 zeigte keines der Tiere mehr klinische Zeichen einer Arthritis. Aufgrund der Behandlung mit dem Antikörper BB5.1 erkrankten weniger Tiere und die Arthritis verlief milder.

Abb. 4.28: Komplementaktivität nach Depletion von C5 in DBA/1 Mäusen. DBA/1 Mäuse wurden mit rhG6PI immunisiert. Das Komplementprotein C5 wurde durch i.p. Injektion von 750 µg des Antikörpers BB5.1 an den Tagen 6, 9 und 12 depletiert. Das Serum dieser Tiere und von unbehandelten Kontrolltieren wurde an Tag 14 nach Immunisierung gewonnen. Sensitivierte Schafserythrozyten wurden mit dem gewonnenen Serum zusammen mit einem C5-defizientem humanen Serum inkubiert. Zur Kontrolle wurden die Erythrozyten nur mit den murinen Kontrollseren oder nur mit dem C5 defizientem Serum inkubiert. Das durch die Lyse freigesetzte Hämoglobin wurde photometrisch vermessen und daraus die mittlere % Lyse ± SEM bestimmt. Die Werte setzten sich aus 10 Tieren, die behandelt wurden, und drei Kontrolltieren zusammen.

Die Effizienz der Blockade des Komplementsystems wurde über die Fähigkeit des Serums zur Hämolyse kontrolliert. Sensitivierte Schafserythrozyten wurden mit dem Serum der behandelten oder der Kontrolltiere in Anwesenheit von C5 freiem humanen Serum inkubiert und die Lyse der Erythrozyten über das freigesetzte Hämoglobin photometrisch vermessen (Abb. [Seite 79↓]4.30). Mausserum ist ohne zusätzliches humanes Serum nicht in der Lage, Erythrozyten zu lysieren. Das C5 freie humane Serum alleine konnte nur 1,3 % der Erythrozyten lysieren. Auch die Kontrollseren der unbehandelten Tiere konnten ohne C5 freiem Serum nur 2,2 ± 0,2 % der Erythrozyten lysieren. Wurden die Kontrollseren zusammen mit dem C5 freiem Serum mit sensitivierten Schafserythrozyten inkubiert, wurden 62,7 ± 7,8 % der Erythrozyten lysiert. Eine verminderte lytische Aktivität zeigten die aus behandelten Mäusen gewonnen Seren auf. Hier konnte wurde nur noch eine Lyse von 43,4 ± 5,6 % gemessen werden. Das entsprach einer durchschnittlichen Reduktion der Komplementaktivität von ungefähr 30 %. Obwohl die Komplementaktivität nicht vollständig blockiert wurde, wurde durch die Behandlung der Tiere mit dem C5 depletierenden Antikörper BB5.1 die Inzidenz und vor allem auch der Verlauf der Arthritis deutlich beeinflusst.

4.4 Die Rolle der T-Zellen und Zytokine in der G6PI-induzierten Arthritis

4.4.1 Zelluläre Antwort auf Glukose-6-phosphat Isomerase nach Immunisierung

Nach Immunisierung mit rhG6PI entwickelten nur Mäuse vom DBA/1 Stamm eine Arthritis. In allen anderen Stämmen mit Ausnahme des DBA/1 DR4-Kim Stammes, wo eines von elf Tieren eine Arthritis entwickelte, wurden kein Tier nach Immunisierung krank. Hier sollte untersucht werden, ob die Zellen aus den drainierenden Lymphknoten nach Immunisierung mit rhG6PI restimuliert werden konnten und nach Erkennung der präsentierten G6PI proliferieren.Dabei sollte die Proliferation zwischen dem suszeptiblen DBA/1 Stamm und den nicht-suszeptiblen Stämmen verglichen werden. Mäuse unterschiedlicher Stämme wurden mit rhG6PI immunisiert und zu unterschiedlichen Zeitpunkten eine Einzelzellsuspension aus den inguinalen Lymphknoten hergestellt. Diese wurden mit rhG6PI restimuliert und die Proliferation über den 3H-Thymidineinbau gemessen. Der Stimulationsindex berechnete sich dabei aus dem Quotienten der Werte mit rhG6PI restimulierten Zellen und der unstimulierten Zellen. Sechs Tage nach der Arthritisinduktion wurde in den DBA/1 Mäusen (Abb. 4.29 A) eine erste zelluläre Antwort gegen G6PI gemessen. An den Tagen 9 und 12 erreichte die zelluläre Antwort gegen G6PI ihren Höhepunkt mit einem mittleren Stimulationsindex von 7,3 ± 0,2. Anschließend nahm die zelluläre Antwort gegen G6PI rapide ab und erreichte an Tag 18 einen mittleren Stimulationsindex von 2,2 ± 0,2. Bei keinem der anderen untersuchten Stämme wurde zu irgendeinem Zeitpunkt ein Stimulationsindex > 3,2 gemessen (Abb. 4.29 B).


[Seite 80↓]

Abb. 4.29: Poliferation von Zellen der inguinalen Lymphknoten nach Restimulation mit rhG6PI. Zellen der inguinalen Lymphknoten von DBA/1 Mäusen (A) oder anderer nicht-suszeptibler Mausstämme (B) wurden zu unterschiedlichen Zeiten nach Immunisierung mit rhG6PI für 72h in 96 Muldenplatten kultiviert. Die Zellen blieben unstimuliert oder wurden mit 10µg/ml rhG6PI restimuliert. In den letzten 16h der Kultur wurde 1µCi 3H-Thymidin zugegeben. Die Proliferation wurde am β-Szintillationszähler gemessen. Der Stimulationsindex war dabei der Quotient aus den Werten, die für rhG6PI restimulierte Zellen gemessen wurden und den Werten , die für die unstimulierten Zellen gemessen wurde. Der Stimulationsindex wurde als Mittel ± SEM angegeben. Zu jedem Zeitpunkt wurden 3 DBA/1 Mäuse bzw. 2 Mäuse anderer Stämme benutzt.

Insgesamt schwankten die gemessenen Stimulationsindices bei den unterschiedlichen Stämmen zwischen 1,5 und 2,5. Die DBA/1 Mäuse zeigten eine schwache, wenn auch deutliche zelluläre Antwort nach Restimulation mit rhG6PI, während die nicht-suszeptiblen Stämme, wie B10.Q, B10.A, AKR, BALB/c, SWR, DR4mix und C57BL/6, keine bzw. gerade detektierbare Antwort zeigten.

4.4.2 Messung der Proliferation der T-Lymphozyten mit CFDA-SE

Die in 4.4.1 dargestellte Proliferation von Zellen aus den inguinalen Lymphknoten ließ keinen Schluss zu, welche Subpopulation von Lymphozyten nach Restimulation mit rhG6PI zur Proliferation angeregt wurde. Da für die weiteren Untersuchungen entscheidend war, ob CD4 T-Lymphozyten an der Pathogenese beteiligt waren, sollte hier untersucht werden, ob CD4 T-Zellen nach Restimulation mit rhG6PI aktiviert wurden und proliferierten.

DBA/1 Mäuse wurden mit rhG6PI in CFA oder mit PBS in CFA immunisiert. An Tag 11 wurden die inguinalen Lymphknoten entnommen und mit CFDA-SE markiert, um die Proliferation am Durchflsszytometer zu verfolgen. Anschließend wurden die Zellen für 72h mit rhG6PI oder rmG6PI restimuliert und dann im FACS gegen CD4 vermessen.

Nach Immunisierung mit PBS in CFA proliferierten nur maximal 0,05% der CD4 T-Lymphozyten nach Restimulation mit rhG6PI oder rmG6PI bzw. ohne Zugabe von Antigen [Seite 81↓](Abb. 4.30). Dies zeigte klar, dass das CFA der Immunisierung und die rhG6PI bzw. rmG6PI alleine keinen Effekt auf die Proliferation von CD4 T-Lymphozyten in der Kultur hatten.

Nach Immunisierung mit rhG6PI proliferierten 0,73% der CD4 T-Lymphozyten spontan ohne Zugabe eines Antigens. Bei Restimulation mit rhG6PI bzw. rmG6PI proliferierten 1,02% bzw. 0,84% der CD4+ Zellen. Nach Restimulation mit rhG6PI oder rmG6PI nahm die Zahl der CD4 T-Lymphozyten, die proliferierten, zu, wobei der Effekt nach Restimulation mit rhG6PI deutlicher war als nach Restimulation mit rmG6PI. Die CD4 T-Lymphozyten zeigten eine spezifische, zugleich aber auch schwache Antwort auf das Antigen mit dem die Tiere immunisiert wurden.

Abb. 4.30: Proliferation der CD4 T-Lymphozyten nach Restimulation mit rhG6PI. DBA/1 Mäuse wurden mit rhG6PI/CFA oder mit PBS/CFA immunisiert. An Tag 11 nach Immunisierung wurden die inguinalen Lymphknoten entnommen und die Zellen mit CFDA-SE markiert. Anschließend wurden die Zellen mit rhG6PI oder rmG6PI restimuliert bzw. blieben unstimuliert. Danach wurden die Zellen gegen CD4 gefärbt, im FACS analysiert und über die Abnahme der CFDA-SE-Intensität die Proliferation bestimmt. Dargestellt ist exemplarisch eine Messung für 1 von 3 Tieren zu diesem Zeitpunkt.

4.4.3 Zytokinproduktion von CD4+ T-Zellen nach Restimulation mit Glukose-6-phosphat Isomerase

Eine wichtige Funktion der CD4 T-Lymphozyten ist die Sezernierung von Zytokinen. Mit Hilfe dieser Zytokine werden unterschiedliche Effektormechanismen initiiert. Daher wurden DBA/1 Mäuse mit rhG6PI immunisiert und an den Tagen 6, 9 oder 11 die Milz und die inguinalen Lymphknoten entnommen. Die Zellen der Milz und der inguinalen Lymphknoten wur[Seite 82↓]den mit rhG6PI für 6h restimuliert. Anschließend wurden die Zellen CD4 gefärbt, fixiert und intrazellulär gegen Zytokine gefärbt. Dabei wurde die Produktion der Zytokine IL-2, TNF-α, IFN-γ, IL-4, IL-17, IL-10 und IL-6 untersucht. Die Spezifität der Färbungen wurde mit unspezifischen fluoreszenzfarbstoffmarkierten Isotypantikörpern kontrolliert.

Abb. 4.31: CD4 + Zellen exprimieren TNF- α , IL-6 und IL-17 nach Restimulation mit rhG6PI. DBA/1 Mäuse wurden mit rhG6PI immunisiert. 11 Tage später wurden die Milz und die inguinalen Lymphknoten entnommen. Die Zellen wurden für 6h mit rhG6PI restimuliert, anschließend CD4 gefärbt, fixiert und intrazellulär gegen IL-2, IL-4, IL-6, IL-10, IL-17, IFN-γ und TNF-α gefärbt. Die Spezifität der Färbungen wurde mittels Isotypantikörper kontrolliert. Die Frequenz der positiven Zellen in den Quadranten ist in % der CD4+ Zellen angegeben. Gezeigt wird die repräsentative Färbung der inguinalen Lymphknoten einer von drei Mäusen an Tag 11.

Abb. 4.31 zeigt eine repräsentative Messung einer Färbung von inguinalen Lymphknotenzellen an Tag 11. Die Messung der Zytokine war spezifisch, da die Isotypantikörper nicht unspezifisch in den Zellen banden. Die Zellen produzierten nach Restimulation mit rhG6PI kein IL-10 und kein IL-2. Unter 0,1% der CD4+ Zellen produzierten IFN-γ und IL-4 nach Abzug der Isotypkontrollen. TNF-α dagegen wurde von 0,3% bis 0,4% der CD4+ Zellen exprimiert. Auch IL-17 wurde von 0,16% und IL-6 von 0,1% der CD4+ Zellen exprimiert. Damit wurden vor allem pro-inflammatorische Zytokine wie TNF-α,IL-17 und IL-6 sekretiert. Neben Tag 11 wurde die Zytokinproduktion der CD4+ T-Zellen auch an den Tagen 6 und 9 untersucht (Abb. 4.32). An diesen Tagen wurden die Milz und die inguinalen Lymphknoten entnommen und nach oben beschriebenem Verfahren durchflusszytometrisch auf die Produktion von Zy[Seite 83↓]tokinen untersucht. Dargestellt sind die Ergebnisse als Mittel ± SEM der Zytokinproduktion der drei an dem jeweiligen Tag untersuchten Tiere. In den inguinalen Lymphkonten war an allen drei untersuchten Tagen TNF-α das am stärksten exprimierte Zytokin. Die Frequenz unter den CD4+ Zellen schwankte dabei zwischen 0,40% an Tag 11 und 0,36% und Tag 6.

Abb. 4.32: Zytokinexpression von CD4+ Zellen nach Restimulation mit rhG6PI. DBA/1 Mäuse wurden mit rhG6PI immunisiert. 6, 9 und 11 Tage später wurden die Milz und die inguinalen Lymphknoten entnommen. Die Zellen wurden mit rhG6PI restimuliert, anschließend CD4 gefärbt, fixiert und intrazellulär gegen IL-2, IL-4, IL-6, IL-10, IL-17, IFN-γ und TNF-α gefärbt. Dargestellt wurden die Ergebnisse von 3 Tieren pro Zeitpunkt als Mittel der Zytokinproduktion der CD4+-Zellen ± SEM.

Daneben wurde vor allem IL-17 produziert. An Tag 6 exprimierten 0,24% der CD4+ Zellen IL-17. Diese Frequenz nahm dann etwas ab und schwankte zwischen 0,15% und 0,18% an den Tagen 9 und 11. Auch IL-6 wurde verstärkt produziert. Dabei schwankte die Produktion [Seite 84↓]in den CD4+ Zellen an den unterschiedlichen Tagen erheblich. Produzierten an Tag 6 noch im Mittel 0,20% der CD4+ Zellen IL-6 und an Tag 11 noch 0,14%, so war an Tag 9 mit 0,03% kein IL-6 detektierbar. Bei allen anderen Zytokinen, die in den CD4+ Zellen der inguinalen Lymphknoten untersucht wurden, lag die Frequenz der Zytokinproduzenten immer unter 0,1% mit Ausnahme von IL-2 an Tag 6, wo 0,14% der CD4+ Zellen IL-2 produzierten.

Ein ähnliches Bild zeigten die CD4+ Zellen der Milz. Auch hier war TNF-α das vorherrschende Zytokin. Die Frequenz lag sogar noch deutlich über der Frequenz in den inguinalen Lymphknoten. An Tag 6 produzierten 1,23% der CD4+ Zellen TNF-α. Die Frequenz nahm dann kontinuierlich ab, so dass an Tag 9 nur noch 0,94% und an Tag 11 0,57% der CD4+ Zellen TNF-α sezernierten. Auch IL-6 wurde in den CD4+ Zellen der Milz zu allen Zeitpunkten exprimiert. An Tag 6 lag die Frequenz bei 0,75%, stieg dann bis Tag 9 auf 1,01% an und fiel schließlich an Tag 11 auf 0,46% ab. Wie in den inguinalen Lymphknoten wurde auch IL-17 gemessen. Die Frequenz der IL-17 exprimierenden CD4+ Zellen schwankte zwischen 0,27% an Tag 6 und 0,12% an Tag 11. Im Gegensatz zu den inguinalen Lymphknoten exprimierten die CD4+ Zellen in der Milz an den Tagen 6 und 9 auch INF-γ mit Frequenzen > 0,20%. IL-10 konnte zu keinem Zeitpunkt detektiert werden. IL-4 wurde nur an Tag 6 mit einer Frequenz von 0,26% der CD4+ Zellen exprimiert. Auch IL-2 war nur an Tag 9 mit einer Frequenz von 0,13% detektierbar. TNF-α, IL-17 und IL-6 waren die vorherrschenden Zytokine, die nach Restimulation von Milz und Lymphknotenkulturen mit rhG6PI exprimiert wurden. Dabei war die Expression der Zytokine in der Milz im Durchschnitt höher als in den inguinalen Lymphknoten.

4.4.4 Prävention der G6PI-induzierten Arthritis durch TNF-Blockade

CD4+ Zellen der rhG6PI immunisierten DBA/1 Mäuse produzierten nach Restimulation mit rhG6PI vor allem TNF-α. Hier sollte untersucht werden, ob TNF-α an der Pathogenese der G6PI-induzierten Arthritis beteiligt ist. Die Funktion des TNF-α sollte mit Hilfe eines löslichen dimeren Rezeptors des TNF-α, dem sTNFR-p75-IgG-Fc (Etanercept), der mit dem Fc-Teil des humanen IgG1 fusioniert wurde, blockiert werden. DBA/1 Mäuse wurden mit rhG6PI immunisiert und wurden täglich bis Tag 9 und anschließend jeden dritten Tag mit 100µg Etanercept in PBS i.p. behandelt. Die Tiere wurden über einen Zeitraum von 30 Tagen beobachtet. 17 der 20 (85%) unbehandelten Tiere erkrankten schon 10 Tage nach Immunisierung (Abb. 4.33 A). Bis zum Tag 19 schwankte die Inzidenz der Arthritis zwischen 70% und 85% und nahm erst dann langsam kontinuierlich ab, bis an Tag 30 nur noch 35% der Kontrolltiere Zeichen einer Arthritis zeigten. Dagegen entwickelten nur 30% der mit Etanercept behandel[Seite 85↓]ten Tiere überhaupt eine Arthritis. Die Entwicklung der Arthritis erfolgte ungefähr eine Woche verzögert im Gegensatz zu den Kontrolltieren, da erst an Tag 16 30% der Tiere krank waren. Die Anzahl der Tiere mit klinischen Zeichen einer Arthritis änderte sich bis Tag 23 nicht deutlich und schwankte zwischen fünf und sechs. Erst von Tag 26 an zeigten nur noch vier Tiere klinische Zeichen einer Arthritis. Die Kontrollgruppe zeigte erste klinische Zeichen einer Arthritis nach 9 Tagen und erreichte an Tag 14 einen maximalen mittleren Arthritisgrad von 5,9 ± 0,5 (Abb. 4.33 B). Anschließend nahm der Schweregrad der Arthritis kontinuierlich ab.

Abb. 4.33: Prävention der G6PI-induzierten Arthritis durch TNF-Blockade. DBA/1 Mäuse wurden mit rhG6PI immunisiert. 20 DBA/1 wurden mit 100µg des dimeren löslichen TNF-Rezeptors p75, der mit dem Fc-teil des humanen IgG1 fusioniert wurde, behandelt (Etanercept). Die Behandlung erfolgte an den Tagen 0 bis 9 täglich und anschließend jeden dritten Tag. Die Entwicklung der Arthritis wurde über 30 Tage verfolgt (A + B). Etanercept behandelte Tiere entwickelten eine Arthritis mit einer Inzidenz von 30% (6/20) (Quadrate) (A). Dagegen erkrankten 85% der Kontrolltiere (17/20) (Dreiecke). Die erkrankten, mit Etanercept behandelten Tiere zeigten eine verzögerte Entwicklung der Arthritis (B) (Quadrate) mit einem geringeren maximalen mittleren Arthritisgrad als die erkrankten Kontrolltiere (Dreiecke). In dem klinischen Verlauf wurden nur die Tiere berücksichtigt, die eine Arthritis entwickelten und diese wurden als Mittel ± SEM dargestellt.

Die erkrankten, mit sTNFR-p75 behandelten Tiere zeigten ein anderes Bild. Zwar entwickelte auch hier schon an Tag 9 eine Maus eine Arthritis. Insgesamt trat die klinische Entwicklung der Arthritis verzögert ein. Erst an Tag 18 erreichten die behandelten Tiere einen maximalen mittleren Arthritisgrad von 4,6 ± 1,0. Dieser Arthritisgrad war zwar deutlich geringer als der maximale mittlere Arthritisgrad der Kontrollmäuse an Tag 14, aufgrund der geringen Zahl der erkrankten, behandelten Tiere aber nicht signifikant (P>0,05 ). Weiterhin wurde die Dosisabhängigkeit der Etanercept Behandlung bei der G6PI-induzierten Arthritis untersucht. Dazu wurden wie oben beschrieben Mäuse mit rhG6PI immunisiert und mit 30µg Etanercept täglich bis Tag 25 behandelt. Alle Kontrolltiere entwickelten schon 10 Tage nach Immunisierung eine Arthritis (Abb. 4.34 A). Bis zum Tag 21 zeigten immer noch 88% der Tiere klinische Zeichen einer Erkrankung. In diesem Experiment konnte über den gesamten Beobachtungszeitraum noch eine Inzidenz der Arthritis von 63% der Tieren beobachtet werden. Die mit [Seite 86↓]30µg Etanercept behandelten Tiere entwickelten, ähnlich wie Mäuse, die mit 100µg behandelt wurden, eine verzögerte Arthritis. Beginnend von Tag 10 entwickelten erst an Tag 18 67% der Tiere eine Arthritis. Anschließend nahm die Inzidenz der Arthritis stetig ab und erreichte von Tag 24 an eine Inzidenz, die zwischen 20% und 26% schwankte. Der klinische Verlauf der Kontrolltiere entsprach den schon zuvor beschriebenen Verläufen. Beginnend von Tag 9 erreichten die Tiere einen maximalen mittleren Arthritisgrad von 6,5 ± 1,0 an Tag 14, der dann langsam auf 3,5 ± 1,0 an Tag 30 abnahm. Der klinische Verlauf der mit 30µg Etanercept behandelten Tiere reflektierte die verzögerte Entwicklung der Arthritis. Beginnend von Tag 10 an nahm der mittlere Arthritisgrad nur langsam zu und erreichte an Tag 18 mit 3,1 ± 0,7 sein Maximum. Der Unterschied zwischen dem maximalem mittleren Arthritisgrad der Kontrolltiere und der behandelten Tiere ist signifikant (Mann Whitney-Test :P<0,05). Nach Tag 18 nahm der klinische Schweregrad der Arthritis wieder langsam ab und ereichte an Tag 30 einen Wert von 1,1 ± 0,5. Auch die Behandlung mit 30µg Etanercept war wirksam. Im Gegensatz zu der Behandlung mit 100µg war die präventive Wirkung jedoch viel geringer, da 67% der mit 30µg behandelten erkrankten anstatt 30% der mit 100µg behandelten. Bei beiden Dosen trat die Arthritis um eine Woche verzögert ein. Zumindest bei der Behandlung mit 30µg war der Verlauf der Arthritis signifikant milder als bei den Kontrolltieren. Bei Behandlung mit 100µg konnte aufgrund der geringen Tierzahl kein signifikanter Unterschied beim maximalen mittleren Arthritisgrad festgestellt werden.

Abb.4.34: Prävention der G6PI-induzierten Arthritis mit einer geringen Dosis Etanercaept. DBA/1 Mäuse wurden mit rhG6PI immunisiert. 15 DBA/1 wurden mit 30µg des dimeren löslichen TNF-Rezeptors p75 behandelt. Die Behandlung erfolgte täglich bis Tag 25 nach Immunisierung. Die Entwicklung der Arthritis wurde über 30 Tage verfolgt (A + B). Etanercept behandelte Tiere entwickelten eine Arthritis mit einer Inzidenz von 67% (10/15) (A, Quadrate). Dagegen erkrankten 100% (8/8) der Kontrolltiere (Dreiecke). Die erkrankten, mit Etanercept behandelten Tiere zeigten eine verzögerte Entwicklung der Arthritis (B, Quadrate) mit einem geringeren maximalen mittleren Arthritisgrad als die erkrankten Kontrolltiere (Dreiecke). In dem klinischen Verlauf wurden nur die Tiere berücksichtigt, die eine Arthritis entwickelten und wurden als Mittel ± SEM dargestellt.


[Seite 87↓]

4.4.5 Therapie der G6PI-induzierten Arthritis durch TNF-Blockade

Die Behandlung mit 100µg Etanercept nach Immunisierung mit rhG6PI wirkte in den meisten Tieren präventiv auf die Entwicklung einer Arthritis. Hier sollte untersucht werden, ob Etanercept auch therapeutisch bei Tieren wirkt, die schon eine Arthritis entwickelt hatten. 16 DBA/1 Mäuse wurden mit rhG6PI immunisiert. Von Tag 11 bis Tag 23 wurden 10 Tiere täglich mit 100µg Etanercept i.p. behandelt. Die anderen Tiere dienten zur Kontrolle. Die Inzidenz und der klinische Verlauf wurden über 30 Tage beobachtet.

Abb. 4.35: Therapie einer entwickelten Arthritis nach G6PI Immunisierung mit Etanercept. DBA/1 Mäuse wurden mit rhG6PI immunisiert, um eine Arthritis zu induzieren. 10 DBA/1 Mäuse wurden mit 100µg des dimeren löslichen TNF-Rezeptors p75 behandelt. Die Behandlung erfolgte täglich von Tag 11 bis Tag 23 nach Immunisierung. Die Entwicklung der Arthritis wurde über 30 Tage verfolgt (A + B). Etanercept behandelte Tiere (A, blaue gefüllte Quadrate) und die 6 Kontrolltiere (A, schwarze gefüllte Dreiecke) entwickelten eine Arthrtis mit einer Inzidenz von 100%. In dem klinischen Verlauf (B) wurden der klinische Index als Mittel ± SEM dargestellt.

Alle Tiere entwickelten nach 10 Tagen eine Arthritis (Abb. 4.35 A). Bei den Kontrolltieren konnten bis Tag 26 bei allen Tieren klinische Zeichen einer Arthritis beobachtet werden. Erst ab Tag 28 nahm die Inzidenz bis auf 50 % an Tag 30 ab. Bei den mit Etanercept behandelten Tieren schwankte die Inzidenz zwischen Tag 19 und Tag 21 zwischen 100 und 80 %. Von Tag 22 an nahm die Inzidenz dann bis auf 20 % an Tag 30 langsam ab. Der klinische Verlauf zwischen beiden Gruppen war ähnlich (Abb. 4.35 B). An Tag 11 erreichten die mit Etanercept behandelten Tieren einen maximalen mittleren Arthritisgrad von 7,7 ± 0,2. An diesem Tag wurde mit der Etanerceptbehandlung begonnen. Anschließend nahm der Grad der Arthritis langsam ab. Trotz Behandlung konnte an Tag 17 noch ein mittlerer Grad der Arthritis von 6,2 ± 0,7 gemessen werden. Erst von Tag 22 an lag der Arthrtitisgrad unter 3 und erreichte an Tag 30 schließlich eine Grad von 0,8 ± 0,5. Die Kontrolltiere ereichten an Tag 13 ihren maxima[Seite 88↓]len Grad der Arthritis von 8,0 ± 0,0. Bis Tag 18 blieb dieser maximale Grad der Arthritis erhalten und nahm dann erst von Tag 19 an langsam ab. An Tag 23 betrug der mittlere Arthritisgrad noch 4,8 ± 0,7 und sank bis Tag 30 auf 0,8 ± 0,4. Bis auf die Tage 20, 21 und 26 ist der klinische Verlauf nicht signifikant unterschiedlich (Mann-Whitney-Test : P<0,05). Die therapeutische Behandlung mit Etanercept zeigt keine Veränderung in der Inzidenz und im klinischen Verlauf in der G6PI-induzierten Arthritis im Vergleich mit unbehandelten Tieren.

4.4.6 CD4+ Zelldepletion in der Induktionsphase der G6PI-induzierten Arthritis

In den Kapiteln 4.4.1 bis 4.4.3 wurde gezeigt, dass sich CD4+ T-Zellen nach Immunisierung mit rhG6PI spezifisch restimulieren lassen und mit der Sekretion von TNF-α, IL-17 und IL-6 antworten. Das von den CD4+ T-Zellen und anderen Zellen produzierte TNF-α war kritisch für die Induktion der G6PI-induzierten Arthritis. Hier sollte untersucht werden, ob CD4+ T-Zellen für die Induktion der G6PI-induzierten Arthritis essentiell sind. Die CD4+ T-Zellen sollten zu unterschiedlichen Zeitpunkten vor der klinischen Manifestation der Arthritis depletiert werden.

Abb. 4.36: Effizienz der CD4-Depletion. DBA/1 Mäusen wurde zu unterschiedlichen Zeitpunkten 300µg des depletierenden Ratte-anti-Maus-CD4 Antikörpers YTS191.1 i.p. injiziert. Zur Kontrolle der Depletion wurde den Mäusen vier Tage nach der letzten Injektion Blut entnommen und gegen CD3, CD4 und CD8 gefärbt und im FACS analysiert. Gezeigt ist die CD4 und CD8 Expression nachdem nur die lebenden CD3+ Lymphozyten angezeigt wurden. Im linken Teil der Abbildung ist die CD4 und CD8 Expression der CD3+ T-Zellen im peripheren Blut naiver DBA/1 Mäuse gezeigt. Der rechte Teil der Abbildung zeigt die CD4 und CD8 Expression der CD3+ T-Zellen im peripheren Blut vier Tage nach der letzten Injektion des Antikörpers YTS191.1.

Die Depletion erfolgte mit dem depletierenden Ratte-anti-Maus CD4 Antikörper, YTS191.1. Zu den angegeben Zeitpunkten wurden den DBA/1 Mäusen 300µg dieses Antikörper i.p. injiziert. Die Effizienz der Depletion lag bei über 90 % (Abb. 4.36). Blut einer naiven DBA/1 [Seite 89↓]Maus wurde gegen CD3, CD4 und CD8 gefärbt und im FACS analysiert. Die Population der CD3+ Lymphozyten teilte sich zu 23 % in CD8 exprimierende T-Lymphozyten und zu 70 % in CD4 exprimierende T-Lymphozyten auf. 4 Tage nach der letzten Injektion des depletierenden Antikörpers YTS191.1 war die CD4+ Population bis auf 1 % reduziert, während die Frequenz der CD8+ T-Zellen auf 79% anstieg. Die CD4+ Lymphozyten wurden zu einem sehr frühen Zeitpunkt (Tag -3, 0, 5), mittleren Zeitpunkt (Tag 6 und 9) und zu einem späten Zeitpunkt (Tag 8 und 11) der Induktionsphase depletiert.

Abb. 4.37: CD4+ Zelldepletion in der Induktionsphase verhindert die G6PI-induzierte Arthritis. DBA/1 Mäuse wurden mit rhG6PI immunisiert und der klinische Verlauf der Arthritis über 30 Tage beobachtet. Die CD4+ Lymphozyten wurden zu unterschiedlichen Zeitpunkten vor oder nach Immunisierung mit dem depletierenden Ratte-anti-Maus-CD4 Antikörper YTS191.1 durch i.p. Injektion depletiert (Quadrate). Die Kontrolltiere erhielten zu den gleichen Zeitpunkten polyklonales Ratten IgG (Dreiecke). Die Depletion erfolgte zu einem frühen Zeitpunkt an den Tagen –3, 0 und 5 vor bzw. nach Immunisierung (A). Hier ist beispielhaft ein Experiment aus zweien mit je fünf Tieren gezeigt. Bei der Untersuchung des mittleren Abschnittes der Induktionsphase erfolgte die Depletion an den Tagen 6 und 9 nach Immunisierung (B). Auch hier wurde beispielhaft ein Experiment aus zweien mit je fünf Tieren gezeigt. Außerdem wurde die Rolle der CD4+ Lymphozyten zu einem sehr späten Zeitpunkt der Induktionsphase untersucht. Hier erfolgte die Depletion an den Tagen 8 und 11 (C). Dargestellt wurden je fünf Mäuse pro Gruppe. Der Verlauf der Arthritisentwicklung wurde als Mittel ± SEM dargestellt.

Die Kontrolltiere erhielten zum gleichen Zeitpunkt polyklonales Ratten IgG und entwickelten alle eine Arthritis. Abb. 4.37 A zeigt den klinischen Verlauf bei der Depletion zum frühen [Seite 90↓]Zeitpunkt. Dargestellt ist beispielhaft ein Experiment mit je fünf Tieren pro Gruppe. Beginnend von Tag 9 entwickelten die Kontrolltiere eine Arthritis mit einem maximalen mittleren Arthritisgrad von 4,8 ± 1,5 an Tag 16, die anschließend abnahm. Im Gegensatz dazu zeigte keines der mit dem Antikörper YTS191.1 behandelten Tiere zu irgendeinem Zeitpunkt im Beobachtungszeitraum von 30 Tagen klinische Zeichen einer Arthritis. Ein vergleichbares Resultat wurde erreicht, wenn die Depletion an den Tagen 6 und 9 nach Immunisierung mit rhG6PI erfolgte (Abb. 4.37 B). Auch hier ist beispielhaft ein Experiment mit fünf Mäusen dargestellt. Die Kontrolltiere entwickelten beginnend von Tag 9 an eine Arthritis, die an Tag 12 mit 6,2 ± 0,8 ihren maximalen mittleren Arthritisgrad erreichte und anschließend abnahm. Auch hier entwickelte keines der mit YTS191.1 behandelten Tiere eine Arthritis. Ein Tier zeigte an Tag 12 an einer Pfote eine leichte Schwellung, die jedoch am Tag darauf nicht mehr zu beobachten war. Abb. 4.37 C zeigt den klinischen Verlauf nach Depletion der CD4+ Lymphozyten zu einem sehr späten Zeitpunkt der Induktionsphase an den Tagen 8 und 11. Die Kontrolltiere zeigten wieder einen normalen klinischen Verlauf der Arthritis mit dem Maximum der Arthritisentwicklung an Tag 12 mit einem mittleren Arthritisgrad von 5,4 ± 0,8. Obwohl die Depletion nur einen Tag vor der klinischen Manifestation der Arthritis durchgeführt wurde, entwickelten nur 2 der fünf mit YTS191.1 behandelten Tiere eine Arthritis mit mildem Verlauf. Bei einem der beiden Tiere beschränkten sich die klinischen Zeichen der Arthritis auf eine Pfote. Das andere Tier zeigte an zwei Gelenken eine Schwellung.

Abb. 4.38: Antikörpertiter gegen G6PI nach Depletion der CD4+ Lymphozyten in der Induktionsphase. DBA/1 Mäuse wurden immunisiert und die CD4+ Lymphozyten zu drei Zeitpunkten (früh: Depletion an Tag –3, 0 und 5; mittel: Depletion an Tag 6 und 9; spät: Depletion an Tag 8 und 11) der Induktionsphase mit dem Ratte-anti-Maus-CD4 Antikörper YTS191.1 depletiert. Die Kontrollgruppe erhielt zum gleichen Zeitpunkt polyklonales Ratten IgG. An Tag 23 nach Immunisierung mit rhG6PI wurde das Serum der Tiere gewonnen und im ELISA auf die Anwesenheit von anti-G6PI Antikörpern getestet. Die höchste Serumverdünnung von je fünf Tieren pro Gruppe bei der anti-G6PI Antikörper noch detektierbar waren, wurden als Mittel ± SEM dargestellt. Die Antikörpertiter der Kontrolltiere wurden zusammengefasst und wurden als Mittel ± SEM von insgesamt 14 Tieren dargestellt.

CD4+ Lymphozyten spielten eine entscheidende Rolle bei Induktion der G6PI-induzierten Arthritis. Die Depletion zu einem sehr frühen und mittleren Zeitpunkt der Induktionsphase [Seite 91↓]verhinderte die Entwicklung der Arthritis völlig, während die Depletion der CD4+ Lymphozyten zu einem späten Zeitpunkt der Induktionsphase noch teilweise protektive Wirkung hatte. Weiterhin wurde untersucht, ob die Depletion der CD4+ Lymphozyten zu den oben beschriebenen Zeitpunkten einen Einfluss auf die Antikörperentwicklung gegen G6PI hatte. Serum dieser Tiere und der Kontrolltiere, die mit polyklonalem Ratten IgG behandelt wurden, wurde an Tag 23 gewonnen und im ELISA auf die Anwesenheit von Antikörpern gegen humane und murine G6PI getestet (Abb. 4.38). Die Antikörpertiter der Tiere, die mit polyklonalen Ratten IgG behandelt wurden, wurden zu einer Gruppe zusammengefasst. Die Kontrolltiere entwickelten an Tag 23 einen mittleren Antikörpertiter gegen humane G6PI von 1:31.085 und gegen murine G6PI von 1:8.114. Erfolgte die Depletion der CD4+ Zellen zu einem Zeitpunkt vor der Immunisierung mit rhG6PI an den Tagen –3, 0 und 5, so war die Entwicklung der anti-G6PI Antikörper stark eingeschränkt. Bei diesen Tieren konnte an Tag 23 ein Antikörpertiter gegen humane G6PI von nur 1:160 gemessen werden. Gegen murine G6PI konnten nur sehr geringe Mengen spezifischer Antikörper detektiert werden. Im Gegensatz dazu entwickelten die Tiere, die an den Tagen 6 und 9 behandelt wurden und keine Arthritis entwickelten, hohe Titer gegen humane und murine G6PI. Die Titer lagen bei der humanen G6PI bei 1:33.280 und bei 1:8.080 bei der murinen G6PI. Einen ähnlichen Befund konnte beobachtet werden, wenn die Depletion an den Tagen 8 und 11 erfolgte. Hier erkrankten nur zwei der fünf Tiere und zeigten einen milden Verlauf. Dennoch entwickelten alle Tiere dieser Gruppe einen Titer gegen die humane G6PI von 1:102.400 und von 1:9.280 gegen murine G6PI. Die Depletion der CD4+ Zellen vor der Immunisierung verhinderte die Entwicklung einer Arthritis in den behandelten Tiere und unterdrückte die Antikörperantwort gegen G6PI fast gänzlich. Bei einer späteren Depletion der CD4+ Zellen in der Induktionsphase entwickelten die Tiere Antikörpertiter, die identisch bzw. sogar höher waren als in den Kontrolltieren.

4.4.7 CD4+ Zelldepletion in der Effektorphase der G6PI-induzierten Arthritis

Im vorangegangenen Kapitel wurde gezeigt, dass CD4+ Lymphozyten für die Entwicklung der G6PI-induzierten Arthritis von entscheidender Bedeutung waren. Hier wurde untersucht, ob CD4+ Lymphozyten auch in der Effektorphase wichtig für den Verlauf der Arthritis sind. DBA/1 Mäuse wurden mit rhG6PI immunisiert. An Tag 11 und 14 nach Immunisierung mit rhG6PI, also zu einem Zeitpunkt, wo die Arthritis schon voll entwickelt war, wurden die CD4+ Lymphozyten mit dem Antikörper YTS191.1 depletiert. Zur Kontrolle wurde eine andere Gruppe mit polyklonalem Ratten IgG zur gleichen Zeit behandelt. Der klinische Verlauf [Seite 92↓]und die Inzidenz wurden über 30 Tage beobachtet (Abb. 4.39). Nach Immunisierung mit rhG6PI entwickelten sowohl die mit YTS191.1 behandelten Tiere als auch die mit Ratten IgG behandelten Kontrolltiere nach 9 Tagen eine Arthritis. Nach 11 Tagen entwickelten alle Tiere in jeder Gruppe eine Arthritis (Abb. 4.39 A). An diesem Tag erfolgte auch die erste Behandlung mit dem depletierenden bzw. dem Kontrollantikörper. Während die Inzidenz der Arthritis bei den Kontrolltieren zwischen dem 11. und 18. Tag zwischen 70% und 100% lag, nahm die Inzidenz der Arthritis bei den mit YTS191.1 behandelten Tiere in diesem Zeitraum auf bis zu 50% ab. Ab Tag 19 nahm die Inzidenz der Arthritis bei den Kontrolltieren kontinuierlich bis auf 40% an Tag 30 ab. Gleiches konnte auch bei den mit YTS191.1 behandelten Tieren beobachtet werden. Hier zeigten ab dem 25. Tag nach Immunisierung nur noch maximal 2 Tiere (20%) leichte Zeichen einer Arthritis.

Abb. 4.39: CD4+ Zelldepletion in der Effektorphase der G6PI-induzierten Arthritis. DBA/1 Mäuse wurden mit rhG6PI immunisiert und die Inzidenz (A) und der klinische Verlauf der Arthritis (B) über 30 Tage beobachtet. Die CD4+ Lymphozyten wurden an den Tagen 11 und 14 nach Immunisierung mit dem Antikörper YTS191.1 durch i.p. Injektion depletiert (Quadrate). Die Kontrolltiere erhielten zur gleichen Zeit polyklonales Ratten IgG (Dreiecke). Insgesamt wurden je 10 Tiere pro Gruppe untersucht. Der klinische Verlauf wurde als Mittel ± SEM je Gruppe dargestellt.

Auch der klinische Verlauf beider Gruppen war bis Tag 11 vergleichbar (Abb. 4.39 B). Beide Gruppen entwickelten ab Tag 9 eine Arthritis. Die mit YTS191.1 behandelten Tiere erreichten an Tag 11 einen maximalen mittleren Arthritisgrad von 6,0 ± 0,7, während die Kontrolltiere an Tag 12 ihren maximalen mittleren Arthritisgrad von 5,3 ± 0,7 erreichten. Bis Tag 15 blieb der Schweregrad der Arthritis bei den Kontrolltieren auf diesem Niveau und nahm dann langsam ab. An Tag 30 betrug der mittlere Arthritisgrad noch 1,6 ± 0,7. Ein anderes Bild zeigten die mit YTS191.1 behandelten Tiere. Schon zwei Tage nach der ersten Antikörperbehandlung nahm der mittlere Arthritisgrad von 6,0 ± 0,7 auf nur noch 2,0 ± 0,6 an Tag 13 ab. Nach der zweiten Behandlung mit YTS191.1 an Tag 14 war der mittlere Arthritisgrad von Tag 18 an bis zum Ende des Beobachtungszeitraumes immer kleiner 1,0. Die Behandlung mit dem CD4+ [Seite 93↓]zellenepletierenden Antikörper führte dazu, dass der klinische Verlauf der Arthritis sofort deutlich milder wurde und zur schnellen Gesundung der Tiere führte. Zwischen dem 13. und 22. Tag waren die klinischen Verläufe der Arthritis zwischen beiden Gruppen nach dem Man-Whitney Test signifikant unterschiedlich mit P<0,05. Neben dem klinischen Verlauf wurden auch die Antikörpertiter gegen G6PI nach der Behandlung mit YTS191.1 oder polyklonalem Ratten IgG an den Tagen 11 und 14 verglichen (Abb. 4.40). Dazu wurde von den eben beschriebenen Tieren an Tag 23 nach Immunisierung Serum gewonnen und im ELISA auf die Anwesenheit von Antikörpern gegen humane und murine G6PI untersucht. Die mit polyklonalem Ratten IgG behandelten Tiere entwickelten einen anti-G6PI Titer von 1:348.160 gegen humane G6PI und 1:21.760 gegen murine G6PI. Die mit YTS191.1 behandelten Tiere entwickelten auch hohe Titer gegen G6PI. Der Antikörpertiter gegen humane G6PI betrug 1:163.840 und 1:13.120 gegen murine G6PI. Obwohl die Depletion der CD4+ Zellen in der Effektorphase zu einer schnellen Gesundung der Tiere führte, entwickelten diese Tiere hohe Antikörpertiter gegen G6PI.

Abb. 4.40: Antikörpertiter gegen G6PI nach Depletion der CD4+ Lympozyten in der Effektorphase. DBA/1 Mäuse wurden immunisiert und die CD4+ Lymphozyten an den Tagen 11 und 14 in der Effektorphase mit dem Ratte anti-Maus CD4 Antikörper YTS191.1 depletiert. Die Kontrollgruppe wurde zum gleichen Zeitpunkt mit polyklonalem Ratten IgG behandelt. An Tag 23 nach Immunisierung mit rhG6PI wurde das Serum der Tiere gewonnen und im ELISA auf die Anwesenheit von anti-G6PI Antikörpern getestet. Die höchste Serumverdünnung bei der anti-G6PI Antikörper noch detektierbar waren, ist als Mittel ± SEM dargestellt.

4.4.8 Die Rolle der CD4+CD25+ Zellen in der G6PI-induzierten Arthritis

CD4+ Lymphozyten waren für die G6PI-induzierte Arthritis sowohl für die Induktion aber auch in der Effektorphase von großer Bedeutung. Eine Depletion dieser Zellen verhinderte die Entwicklung der Arthritis bzw. führte zur schnellen Gesundung der Tiere. Eine Subpopulation der CD4+ T-Zellen exprimiert CD25. Diese Zellen werden auch als regulatorische T-Zellen bezeichnet, wobei nicht alle CD4+CD25+ Zellen regulatorisch sind. Sie sind an der Aufrecht[Seite 94↓]erhaltung der peripheren Toleranz gegen körpereigene Antigene beteiligt. Hier sollte untersucht werden, ob CD4+ CD25+ Zellen an der Entwicklung und am Verlauf der G6PI-induzierten Arthritis beteiligt sind. CD4+ CD25+ Zellen wurden mit Hilfe des depletierenden Ratte anti-Maus CD25 Antikörpers pC61.5 depletiert. DBA/1 Mäusen wurden an den Tagen –28, -25, -21 und –14 vor Immunisierung mit rhG6PI mit 400µg des Antikörpers pC61.5 i.p. in PBS behandelt. Sowohl die CD25 depletierten DBA/1 Mäuse als auch die Kontrolltiere entwickelten eine Arthritis, die dem normalen zeitlichen Ablauf entsprach (Abb. 4.41 A). 11 Tage nach Immunisierung entwickelten 100% beider Gruppen eine Arthritis. Bis Tag 25 zeigten alle mit pC61.5 behandelten oder unbehandelten Tiere klinische Zeichen einer Arthritis. Anschließend lag die Inzidenz der Arthritis bei den pC61.5 behandelten Tieren über den gesamten Beobachtungszeitraum bei ca. 90%.

Abb. 4.41: Depletion der CD4+ CD25+ Zellen in der G6PI-induzierten Arthritis. 10 DBA/1 Mäuse wurden an den Tagen –28, -25, -21 und –14 vor Immunisierung mit rhG6PI mit 400µg des CD25+ Zellen depletierenden Antikörpers pC61.5 i.p. behandelt (Quadrate). 9 DBA/1 Mäuse blieben unbehandelt und wurden an Tag 0 mit rhG6PI immunisiert (Dreiecke). Die Inzidenz (A) und der klinische Verlauf der Arthritis (B) wurden über einen Zeitraum von 51 Tagen beobachtet. Der klinische Verlauf wurde als Mittel der erkrankten Tiere ± SEM dargestellt.

Bei den unbehandelten Kontrolltieren nahm die Inzidenz nach Tag 25 ab und schwankte zwischen 43-57%. Der klinische Verlauf beider Gruppen zeigte deutliche Unterschiede (Abb. 4.41 B). Sowohl die Kontrolltiere als auch die mit pC61.5 behandelten Tiere erreichten ihren maximalen mittleren Arthritisgrad an Tag 15 mit 7,6 ± 0,4 bei den behandelten Tieren und 7,9 ± 0,1 bei den Kontrolltieren. Bei den unbehandelten Tieren nahm der mittlere Arthritisgrad danach kontinuierlich ab und erreichte an Tag 34 einen Wert von 1,4 ± 0,6. Bis zum Ende des Beobachtungszeitraumes blieb dieser Wert ungefähr gleich. Ein anderes Bild zeigten die mit pC61.5 behandelten Tiere. Der mittlere Arthritisgrad nahm bis zum Ende des Beobachtungszeitraumes an Tag 51 kaum ab und besaß an Tag 51 immer noch einen Wert von 5,4 ± 1,1. Die klinischen Verläufe beider Gruppen unterschieden sich von Tag 25 an signifikant mit P<0,05. Neben den unterschiedlichen klinischen Verläufen zeigte auch die histologische Un[Seite 95↓]tersuchung an Tag 34 nach Immunisierung deutliche Unterschiede zwischen beiden Gruppen. Die mit pC61.5 behandelten Tiere zeigten noch 34 Tage nach Immunisierung eine hochgradige, florierende, chronische und destruktive Synovitis mit Pannusbildung (Abb. 4.42 A) während die Kontrolltiere an Tag 34 nur eine leicht verdickte Synovialmembran zeigten, die einer gering florierenden, chronischen aber nicht destruktiven Synovitis entsprach (Abb.42 B). Bisher konnte nur in dem DBA/1 Mausstamm eine Arthritis nach Immunisierung mit rhG6PI induziert werden. Nachdem gezeigt wurde, dass die Depletion von CD25+ Zellen zu einem chronischen Verlauf der Arthritis in DBA/1 Mäusen führte, sollte untersucht werden, ob auch ein nicht-suszeptibler Stamm eine Arthritis nach CD25+ Zelldepletion entwickelt.

Abb. 4.42: Histologische Analyse nach Depletion der CD25+ Zellen in DBA/1 Mäusen. DBA/1 Mäuse wurden an den Tagen –28, -25, -21 und –14 vor Immunisierung mit rhG6PI mit 400µg des CD25+ Zellen depletierenden Antikörpers pC61.5 i.p. behandelt oder blieben unbehandelt. An Tag 34 nach Immunisierung wurden die Mäuse histologisch untersucht. Gezeigt ist eine HE-Färbung (100fache Vergrößerung) eines Gelenkschnittes einer Pfote einer Maus, die mit pC61.5 behandelt wurde (A). Der Pfeil markiert die hochgradig florierende, chronische und destruktive Synovitis vom Grad 3 und eine Pannusbildung. Im Gegensatz zeigt das unbehandelte Tier (B) eine leicht verdickte Synovialmembran und mit einer leichten Synovitis (Pfeil).

5 BALB/c Mäuse und 5 DBA/1 Mäuse wurden mit dem CD25-depletierenden Antikörper pC61.5 wie oben beschrieben behandelt und an Tag 0 mit rhG6PI immunisiert. 5 DBA/1 erhielten zur Kontrolle an den gleichen Tagen eine Behandlung mit polyklonalem Ratten IgG und wurden anschließend auch mit rhG6PI immunisiert. Die Entwicklung der Arthritis wurde über einen Zeitraum von 22 Tagen verfolgt (Abb. 4.43). Anschließend wurden die Tiere an Tag 22 histologisch untersucht. Sowohl die mit pC61.5 als auch die mit Ratten IgG behandelten Tiere entwickelten nach 8 Tagen eine Arthritis. An Tag 10 zeigten bereits alle pC61.5 behandelten DBA/1 Mäuse eine Arthritis und 4/5 mit Ratten IgG behandelte Tiere. An Tag 10 zeigte nur 1:5 der BALB/c Mäuse eine leichte Schwellung an einer Pfote. Beide Gruppen der DBA/1 Mäuse erreichten an Tag 12 ihren maximalen mittleren Arthritisgrad mit 8,0 ± 0 bei [Seite 96↓]den Tieren, die mit dem anti-CD25 Antikörper behandelt wurden. Bis zum Ende des Beobachtungszeitraums zeigten diese Tiere keine Besserung.

Die Ratten IgG behandelten Tiere erreichten einen Wert von 6,2 ± 1,5. Anschließend nahm der Arthritisgrad langsam ab, zeigte an Tag 22 aber immer noch eine Wert von 5,0 ± 1,7. Die BALB/c Tiere entwickelten bis auf ein Tier klinisch keine Arthritis. Das Tier, dass erkrankte, zeigte an Tag 10 an einer Pfote eine leichte Schwellung, die von Tag 17 an bis zum Ende des Beobachtungszeitraum jeden Tag deutlich zu beobachten war.

Abb. 4.43: CD25 Depletion und Arthritisinduktion mit G6PI in BALB/c Mäusen. 5 DBA/1 Mäuse (gefüllte blaue Dreieicke). bzw. 5 BALB/c Mäuse (umgedrehte blaue Dreiecke) wurden an den Tagen –28, -25, -21 und –14 vor Immunisierung mit rhG6PI mit 400µg des CD25+ Zellen depletierenden Antikörpers pC61.5 i.p. behandelt. DBA/1 Mäuse wurden zur gleichen Zeit mit polyklonalem Ratten IgG behandelt und an Tag 0 mit rhG6PI immunisiert (gefüllte schwarze Dreiecke). Der klinische Verlauf der Arthritis wurde über einen Zeitraum von 22 Tagen verfolgt. Der klinische Verlauf wurde als Mittel aller Tiere einer Gruppe ± SEM dargestellt. 5/5 pC61.5 behandelte Tiere, 4/5 mit Ratten IgG behandelte Tiere und 1:5 der BALB/c Mäuse erkrankten.

Eine histologische Analyse dieses Gelenks (Abb. 4.44) zeigte eine leichte Infiltration der synovialen Deckzellschicht, die zu einer leichten Verdickung führte und einem Grad 1 der Synovitis entsprach. Knorpel- oder Knochendestruktionen wurden nicht beobachtet. Die Depletion von CD25+ Zellen führte zu einem chronischen Verlauf der Arthritis in den DBA/1 Mäusen. Trotz Depletion erkrankte nur eine von fünf BALB/c Mäusen. Histologisch und auch klinisch war der Verlauf der Arthritis in dieser Maus sehr mild. Insgesamt waren nur die Gelenke einer Pfote betroffen.


[Seite 97↓]

Abb. 4.44: Histologische Analyse nach Depletion der CD25+ Zellen in BALB/c Mäusen. BALB/c Mäuse wurden an den Tagen –28, -25, -21 und –14 vor Immunisierung mit rhG6PI mit 400µg des CD25+ Zellen depletierenden Antikörpers pC61.5 i.p. behandelt. An Tag 22 nach Immunisierung wurden die Mäuse histologisch untersucht. Gezeigt ist eine HE-Färbung (100fache Vergrößerung) eines Gelenkschnittes einer Pfote einer Maus, die klinisch eine leichte Arthritis entwickelte. Der Pfeil markiert die Synovitis vom Grad 1 in einem Gelenk dieser Pfote.


© Die inhaltliche Zusammenstellung und Aufmachung dieser Publikation sowie die elektronische Verarbeitung sind urheberrechtlich geschützt. Jede Verwertung, die nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung. Das gilt insbesondere für die Vervielfältigung, die Bearbeitung und Einspeicherung und Verarbeitung in elektronische Systeme.
DiML DTD Version 4.0Zertifizierter Dokumentenserver
der Humboldt-Universität zu Berlin
HTML-Version erstellt am:
24.06.2005